KEGG   Pantoea gaviniae: C2E15_19520Help
Entry
C2E15_19520       CDS       T05418                                 

Definition
(GenBank) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
pgz  Pantoea gaviniae
Pathway
pgz00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:pgz00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    C2E15_19520
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pgz02000]
    C2E15_19520
Enzymes [BR:pgz01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     C2E15_19520
Transporters [BR:pgz02000]
 Other Transporters
  Pores ion channels [TC:1]
   C2E15_19520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 Tom37 GST_N_4
Motif
Other DBs
NCBI-ProteinID: AUX95037
UniProt: A0A1X1E4G7
LinkDB All DBs
Position
complement(4158793..4159458)
Genome map
AA seq 221 aa AA seqDB search
MIVVHHLNNSRSQRILWLLEELELPYEIKRYQRQASMLAPAELKKIHPLGKAPVIVDGER
VVAESGAILEYLAERYDRNRLLTPLDKDEALECRYWLHYAEGSLMPLVVMRLIFSRMGKP
PVPWLLRPIGAAFGNGVRKGFLDKQLATHRQFIEQHLTKQPWFAGQHLTLADIQMSFPIQ
GLSARGGLDDMPATQAWLDKISRRPAWQRAIQQGGELNLPD
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgatcgtggtgcatcacctgaataactcccgctctcagcgcattctctggctgctggaa
gagctggagctgccgtatgaaatcaaacgctatcagcgccaggcgtcaatgctcgccccg
gcagagctgaaaaaaattcacccgctgggcaaggcgccggtgattgtcgacggcgagcgc
gtggtagcggaatcgggcgcgatcctggaatatctggcggaacgttatgaccgcaaccgg
ctgctgacgccgctggataaggatgaggcgctggagtgccgctactggctgcactatgcg
gaagggtcgctgatgccgctggtggtgatgcgcctgatcttcagccgtatgggcaagcca
ccggtgccctggctactgcgcccgatcggcgcggcgttcggcaatggggtgcgcaaaggc
tttctcgataagcagctggccacgcatcgccagtttatcgaacagcatctgacgaagcag
ccatggtttgccggccagcatctgacgctggccgatattcagatgagctttcccatccag
gggctgtcggcgcgcggcggtcttgacgatatgcccgccacgcaggcctggctggataaa
atcagccgccgtcccgcctggcagcgcgcgatccagcagggcggcgaactgaatctgccc
gattag

DBGET integrated database retrieval system