KEGG   Pseudoalteromonas haloplanktis: PSHAa0311Help
Entry
PSHAa0311         CDS       T00282                                 

Gene name
pstB
Definition
(GenBank) Phosphate import ATP-binding protein pstB(Phosphate-transporting ATPase)(ABC phosphate transporter)
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:pha00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    PSHAa0311 (pstB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pha02000]
    PSHAa0311 (pstB)
Enzymes [BR:pha01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     PSHAa0311 (pstB)
Transporters [BR:pha02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    PSHAa0311 (pstB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N RsgA_GTPase AAA_22 AAA_16 AAA_29 ABC_ATPase AAA_23 AAA_15 ATP-synt_ab AAA AAA_25 AAA_33 Rad17 NB-ARC Adeno_IVa2 AAA_18 AAA_30
Motif
Other DBs
NCBI-ProteinID: CAI85410
UniProt: Q3ILC5
LinkDB All DBs
Position
I:325669..326496
Genome map
AA seq 275 aa AA seqDB search
MISVAPKVNQANTSLKLDLDNLTTEQTALEIKDLDLYYGDKQALSKVNMNIPKGQVTAFI
GPSGCGKSTLLRCINRMNDLVDICRIEGEILLHGQNIYDKSVDVAALRRNVGMVFQRPNP
FPKSIYENVVYGLRLQGIKDKRKLDEVVEQSLRGAALWDEVKDRLHDSAFGLSGGQQQRL
VIARSIAISPEVLLLDEPTSALDPISTLVIEELINDLKSKFTVVIVTHNMQQAARVSDQT
AFMYMGELIEYSDTNTLFTTPNKKKTEDYITGRYG
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgatttcagtcgctccaaaagtaaatcaagccaataccagcttgaagttagacttagac
aatttaaccacagagcaaacagcgttagagattaaagatctcgatctttactacggcgat
aaacaagcgctgagtaaagtaaatatgaatattccaaagggccaggtaacagcctttatt
ggcccgtcggggtgtggtaaatcaaccttattacggtgtattaaccgcatgaacgactta
gttgatatttgccgcatagaaggtgaaatactgctacatggacaaaacatttacgataaa
agcgttgatgtagcggcgctgcgtcgtaacgtaggcatggtatttcagcgacctaaccct
tttcctaaatcaatttatgaaaatgtggtttatggtttgcgcttacaaggtattaaagac
aaacgtaaattagatgaagtagttgagcaatcattgcgtggtgcagcgctgtgggatgaa
gtaaaagacaggctacacgacagcgcttttgggttgtcgggtggacagcagcaacgttta
gttattgcgcgctcaattgctatttcgccagaagtattactgcttgatgaacctacctcg
gcactagaccctatttctactttagtaatagaggagctaattaacgatttaaagagcaag
tttacagtggtaattgttacccataatatgcaacaggccgcccgggtttctgaccaaacg
gcgtttatgtatatgggggagctaattgaatactcagacaccaacaccttatttacaacg
cctaataagaaaaaaacagaagactatataaccggtcgttacggctaa

DBGET integrated database retrieval system