KEGG   Pseudoalteromonas haloplanktis: PSHAa1648Help
Entry
PSHAa1648         CDS       T00282                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase, Fe-S protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00020  Citrate cycle (TCA cycle)
pha00190  Oxidative phosphorylation
pha00650  Butanoate metabolism
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
pha01200  Carbon metabolism
Module
pha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSHAa1648 (sdhB)
   00650 Butanoate metabolism
    PSHAa1648 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PSHAa1648 (sdhB)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PSHAa1648 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PSHAa1648 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_18 Fer4_7 Fer4_9 Fer4
Motif
Other DBs
NCBI-ProteinID: CAI86721
UniProt: Q3IGW2
LinkDB All DBs
Position
I:complement(1718194..1718910)
Genome map
AA seq 238 aa AA seqDB search
MAQVQFSVYRYNPDVDNAPRMQEYTLQTEEGHDMMVLDALILLKEQDPTLSFRRSCREGV
CGSDGVNMNGKNGLACITPLSTLQKGGKGKIVVRPLPGLPVVRDLVIDMSQFYTQYEKVK
PYLINDTPAAGERLQTIEERDKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYR
FLADSRDTATEERLADLDDAFSVFRCHSIMNCVSVCPKGLNPTKAIGQIKSMLLNRAV
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atggcacaagtacaattttcagtttatcgttataatcccgatgttgacaacgcacctcgt
atgcaagaatacaccttgcaaacagaggaaggtcacgacatgatggttttggatgcactt
attcttttaaaagaacaagatccaacattatctttccgtcgttcatgccgtgaaggtgtg
tgtggatctgatggtgttaacatgaatggtaaaaatggtttggcatgtatcactccttta
tctacgctgcaaaaaggtggcaaaggtaaaatagtagtgcgtccattaccaggcttacct
gtggttcgtgaccttgttattgacatgagtcagttctacactcaatacgaaaaagttaaa
ccgtatctaattaatgacacgccagcagctggcgagcgtcttcaaacaatcgaagaacgt
gataagttagatgggctttatgagtgtattttatgtgcatgttgttcaacatcgtgtcct
tcgttctggtggaatccagacaagttcattggtccagcaggccttcttcatgcttaccgt
ttcttggctgatagccgagatacagcaacagaagagcgtttagctgacttagacgatgct
ttcagtgtgttccgttgccacagtataatgaactgtgttagcgtttgtcctaaaggtctt
aatccgaccaaagcaattggacaaataaaatctatgttattaaaccgagcggtttaa

DBGET integrated database retrieval system