KEGG   Pseudoalteromonas haloplanktis: PSHAa1649Help
Entry
PSHAa1649         CDS       T00282                                 

Gene name
sdhA
Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00020  Citrate cycle (TCA cycle)
pha00190  Oxidative phosphorylation
pha00650  Butanoate metabolism
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha01130  Biosynthesis of antibiotics
pha01200  Carbon metabolism
Module
pha_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pha_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pha_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PSHAa1649 (sdhA)
   00650 Butanoate metabolism
    PSHAa1649 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PSHAa1649 (sdhA)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PSHAa1649 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     PSHAa1649 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA HI0933_like DAO FAD_binding_3 Thi4
Motif
Other DBs
NCBI-ProteinID: CAI86722
UniProt: Q3IGW1
LinkDB All DBs
Position
I:complement(1718921..1720693)
Genome map
AA seq 590 aa AA seqDB search
MKYSVREFDAVVIGAGGAGMRAALAITESGKTCALISKVFPTRSHTVSAQGGITVALGNS
HEDNWEWHMYDTVKGSDFIGDQDAIEYMCQTGPEAITELENMGLPFSRFENGRVYQRPFG
GQSKNFGGEQAARTAAAADRTGHALLHLLYQQNVKNKTNVFSEWYALDLVKNDNGDVVGC
TAIEIETGEITYFKSKAVVLATGGAGRIFASTTNAHINTGDGVGMATRAGISMQDMEMWQ
FHPTGIAGAGTLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLASRDVVARSMMTEIREG
RGCDGPWGPHLKLKLDHLGAETLNLRLPGVCDLAKTFAHVDPAKEPIPVIPTCHYMMGGV
PTNVNGQALQIDANGKETIVEGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGNFLG
KYLNDVEISKAASESDLETSLARYNRWENSTAGQGEDPVQIKKDLQQCMQLNFSVFREGD
SMAAGLQELKEIRERLQHARLDDKSSDFNTQRIECLELDNLMETAYSTAVAANFRTESRG
AHSRFDFPDRDDENWLCHSVFNPLTDEMSKRDVNYAPKSREAFPPKARVY
NT seq 1773 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatattctgttcgtgaatttgacgccgtagtaatcggtgccggtggtgcaggtatg
cgcgctgctttagctattactgagtctggcaaaacgtgtgctttaatctctaaagtattt
ccaactcgctcacacactgtatcagcacagggtggtattacagtagcgcttggtaactcg
cacgaagataactgggaatggcacatgtacgataccgttaagggctccgattttatcggt
gaccaagacgctattgaatatatgtgtcaaacaggcccagaagctattactgaattagaa
aacatgggtctcccattttctcgctttgaaaatggccgtgtttaccaacgtcctttcggt
ggtcaatcgaaaaactttggtggtgaacaagctgcacgtactgcggcagctgccgatcgt
actggtcacgcactattacaccttctttatcaacaaaatgttaaaaacaaaacaaatgta
ttctcagaatggtatgcacttgatttagttaaaaacgataatggtgatgtagtaggttgt
actgcaattgaaattgaaacaggtgaaatcacttatttcaaatctaaagcagtagtatta
gcaacaggtggtgcgggtcgtatttttgcatcaactactaatgcgcacatcaacaccggc
gatggcgttggtatggcaacacgtgctggtatttctatgcaagatatggaaatgtggcag
ttccacccaacgggtattgctggcgcgggtacgctagtaactgaaggttgtcgtggcgaa
ggtggttatcttttaaataaagatggcgagcgcttcatggaacgttatgcaccaaacgca
aaagacttagcgtctcgcgatgtggttgcacgttcaatgatgactgagatccgtgaaggt
cgtggttgtgatggtccttggggtcctcaccttaagctaaaactagatcacttaggtgca
gaaacactaaatctgcgtcttcctggtgtatgtgaccttgctaaaacatttgctcacgtt
gaccctgcaaaagaaccaattccagtaattcctacatgtcattacatgatgggtggcgtg
ccaaccaacgtaaatggtcaagcgctacaaatcgacgcaaacggcaaagaaacaatcgtt
gaaggtttgtttgcggtaggtgagattgcctgtgtatcagtacacggtgctaaccgctta
ggtggtaactcattacttgatttagtggtatttggtcgtgcggccggtaacttcttaggt
aaatacctaaatgatgttgaaatttctaaagcggcatcagagtctgatttagaaacatca
cttgcacgttacaatcgttgggaaaattcaacggctggccaaggtgaagatccagttcaa
atcaaaaaagacttacagcaatgtatgcaacttaacttctcggtatttcgtgaaggtgac
tcaatggctgctggtctgcaagaacttaaagaaattcgtgaacgtctgcaacatgcacgt
cttgatgataaatcatcagacttcaacacgcagcgtattgaatgtcttgaactagataac
ttaatggaaacagcttactcaactgcagtagctgcaaacttccgtaccgaaagccgtggt
gcacattctcgctttgacttcccagatcgtgatgacgaaaactggttatgtcactcagta
tttaatccgttaacggatgaaatgagcaagcgtgacgtaaactacgcgcctaagtcgcgt
gaagctttcccacctaaagcacgtgtgtactag

DBGET integrated database retrieval system