KEGG   Pseudoalteromonas haloplanktis: PSHAa2293Help
Entry
PSHAa2293         CDS       T00282                                 

Definition
(GenBank) putative cysteine sulfinic acid decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
pha  Pseudoalteromonas haloplanktis
Pathway
pha00250  Alanine, aspartate and glutamate metabolism
pha00410  beta-Alanine metabolism
pha00430  Taurine and hypotaurine metabolism
pha00650  Butanoate metabolism
pha01100  Metabolic pathways
pha01110  Biosynthesis of secondary metabolites
pha01120  Microbial metabolism in diverse environments
pha02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    PSHAa2293
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PSHAa2293
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    PSHAa2293
   00430 Taurine and hypotaurine metabolism
    PSHAa2293
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    PSHAa2293
Enzymes [BR:pha01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     PSHAa2293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAI87349
UniProt: Q3IHV8
LinkDB All DBs
Position
I:complement(2436723..2438348)
Genome map
AA seq 541 aa AA seqDB search
MDQKRFAVASKESLKRIFTVPEAPDSTLSKIELEISSNLAGFLNENIAAIEKPLHEIEKD
FQSAMIPEDPTFVSAYAQDIMEQLVAHSVHTAAPSFIGHMTSALPHFLLPLSKLMVGLNQ
NLVKIETSKAFTPLERQVLGMMHHLAYGQQDEFYAKWMHSAKTSLGAFCSGGTVANITAL
WIARNRLLKPDGDFRGIGAQGLIAGMLHYGYKGLAILISERGHYSLGKAADLLGIGRENL
VGIKTCENNKVDVNAMREKALELEAQGIKVMAIIGVAGTTETGNIDPLEAMADLAQDINC
HFHVDAAWGGATLLSNTHRHLLKGVERADSITIDAHKQMYVPMGAGLVLFKDPTATDAIE
HHAEYILRKGSKDLGSHTLEGSRPGMAMLVHACLRVIGRKGYEMLIDRSIKKTHYFANLI
KADEDFELISEPELCLLTYRYVPKQIKQAIADADPQTRIDIFASLNRFTASMQKRQRESG
RSFVSRTRLTPTQYDNQPTVVFRVVLANPLTSGVILKEILAEQKELAKTDPVFKKYLSKY
M
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atggatcaaaagcgttttgccgtcgcctctaaagaaagccttaagcgtatatttactgta
cctgaagcgccagactcaactttaagcaaaatagagcttgaaatatcgagtaatttagca
ggttttttaaacgaaaacattgcggcaattgaaaaaccattacacgaaattgaaaaagac
tttcagtcggcgatgatcccagaggatccaacgtttgtatctgcttatgcgcaagatata
atggagcagctggttgcacactctgtgcataccgcagcgcctagctttattggccatatg
acttcagctttacctcattttttactaccactgtcaaagctaatggtagggctaaatcaa
aacctagtaaaaatagaaacctctaaagcttttaccccacttgagcgccaagtgcttgga
atgatgcaccatttagcgtacgggcagcaagacgagttttatgctaaatggatgcacagt
gcaaaaacatcattaggtgcattttgctcaggcggtactgtagccaatattacggcgtta
tggattgcgcgaaatcgcttattaaaacctgatggcgattttaggggaataggcgcacaa
ggcttaattgccggtatgctgcattacggctataaaggcttagctattttaatttctgag
cgaggccattattcgttaggtaaagcggctgatttattaggaattggtcgtgaaaactta
gtgggtattaaaacatgcgaaaacaataaagttgatgttaatgccatgcgcgaaaaagcc
ttagagcttgaagcgcaaggtattaaagtaatggccattattggagtagcgggtaccaca
gaaaccggtaatatcgatccccttgaagcgatggcagatttagcacaagacattaattgc
cactttcatgttgacgctgcatggggcggggcaactttgttatctaatacccatcgccat
ttactcaaaggtgttgagcgcgcagactcaattaccattgatgcacacaaacaaatgtat
gttcctatgggagctgggttggtgttgtttaaagatccaaccgctaccgatgcaattgaa
catcatgcagagtatattttacgtaaaggctcaaaagatttaggtagccatacacttgag
ggcagccgcccaggtatggcaatgttagtacatgcttgcttacgtgtaattggccgtaaa
ggctacgaaatgctaatcgatcgtagtattaaaaaaacccattactttgctaatttaatt
aaagcagatgaagattttgagctgatctcagagccagagctgtgcttattaacgtatcgt
tatgtgcctaagcaaataaagcaggcaattgcagatgctgatccacaaacacggattgat
atttttgcctcacttaatcgctttactgcaagtatgcaaaaacggcaacgtgaatcaggg
cgatcatttgtatcacgtacgcgtttaacgcctactcaatacgataatcagcccaccgtg
gtatttagggtagtacttgctaacccacttacatcaggcgttattttaaaagaaatttta
gcagaacaaaaagagttggctaaaacagatccggtatttaaaaagtatttaagcaagtat
atgtaa

DBGET integrated database retrieval system