KEGG   Pseudoalteromonas haloplanktis: PSHAb0266Help
Entry
PSHAb0266         CDS       T00282                                 

Gene name
ahpF
Definition
(GenBank) Alkyl hydroperoxide reductase subunit F (Alkyl hydroperoxide reductase F52A protein)
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
pha  Pseudoalteromonas haloplanktis
Brite
KEGG Orthology (KO) [BR:pha00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PSHAb0266 (ahpF)
Enzymes [BR:pha01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PSHAb0266 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 DAO FAD_oxidored NAD_binding_9 FAD_binding_3 Thi4 NAD_binding_8 K_oxygenase AlaDh_PNT_C Lycopene_cycl Glutaredoxin Amino_oxidase Thioredoxin_9
Motif
Other DBs
NCBI-ProteinID: CAI89307
UniProt: Q3IDA7
LinkDB All DBs
Position
II:311707..313278
Genome map
AA seq 523 aa AA seqDB search
MLDNNIKNQLKSHFESLTQPVELLIALDDSKKSTEVASLANDLASLSDKFTVINNPDTSA
RRPSMVVHSPIKNTHITFAGVPMGHEFTSLVLALLHTGGHASKAKAEDIEQIKSLDQALN
FEVYISLSCQTCPQVVQALNTMAATNNKIKATMIDGALFQGEVEERNILAVPAVYLNGEP
FSQGALSLTDILNKVDSKGAQRQAESLSKKEKFDVLVIGGGPAGASAAIYSARKGLNTGI
VADRFGGQVADTLAIENFISIKATEGPKLVAQLEEHVKEYDVDVMHNQRAAKLSRNNNGY
EITLENGAVLSAKSLVLATGARWREMNVTGEQQYRGHGVAYCPHCDGPLFKGKPVAVIGG
GNSGIEAAIDLANIVEHVTVLEFADTLRADEVLIRKASSMANITIIKSAQTTEVLGDGKK
VTGLTYTDRVSGDSKQLTLAGIFVQIGLIPNTEWLKDSELELSKFGEILIDAKGATSLPG
VYGAGDATNTPFKQIIIAMGSGATASLGAFDYLIRHSDETEQA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgttagataacaacataaaaaatcaattaaaaagccattttgaatcgcttactcaacct
gttgagctgcttatcgccttggacgacagcaaaaaatcaacagaagtagcaagcttagca
aacgatttagcctcactaagcgataaatttacggtaataaacaacccagacacaagcgcg
cgtcgtccgtcaatggttgtacattcacctattaaaaacacccatattacctttgcgggt
gtacctatgggccacgaattcactagtttagtgttagcgctgttgcacactggcggacat
gccagtaaagcaaaagccgaggacattgaacaaataaagtcgctcgaccaagcgcttaat
tttgaagtgtatataagcttaagttgtcaaacctgcccacaagtagtgcaggctttaaat
acaatggcagcaactaataataaaattaaagccaccatgatagatggcgcgttatttcaa
ggcgaagtagaagagcgcaacattttagctgtaccggctgtttatttaaatggcgaacca
tttagccaaggtgcactaagcctaaccgacatactcaataaagtagatagcaaaggtgca
cagcgccaagctgagtcgttaagtaaaaaagaaaagtttgacgtgttagttattggtggt
gggcctgcgggtgcatcggctgctatttactcagcacgaaaagggttaaacaccggtatt
gttgcagataggtttggcggacaagtagccgatactttagcaatcgaaaactttatttcg
attaaagccaccgaagggccaaaactggtagcacaactagaagagcacgttaaagaatac
gatgtagatgtaatgcataatcaacgcgcagctaagcttagtcgcaataataatggttac
gaaattactctagaaaacggcgcggtactgagtgctaagtcgctggtactggcaacaggc
gcacgctggcgcgaaatgaacgtgactggcgagcaacaatatcgtggccacggtgtggca
tattgcccacattgcgatgggcccttatttaaaggcaaaccggttgcggtaattggtggc
ggtaattcaggtatagaagccgcgattgatttagccaatattgtagagcatgtaacggta
cttgaatttgccgatacattacgtgccgacgaagtacttattcgcaaagctagcagtatg
gctaatattactattattaaaagtgcacaaacaaccgaagtactcggtgatggcaaaaaa
gtaaccggtttaacttacaccgaccgcgtaagtggcgacagtaagcaactcactcttgcg
ggcatatttgtacaaattggtttaataccaaatacagaatggctaaaagacagtgagctt
gaactgagcaaatttggtgagattttaattgatgccaaaggcgcaacatcactcccaggc
gtttatggcgcgggggatgcaaccaatacgccatttaagcaaataataattgctatgggc
agtggtgcaacagccagtttaggtgcgtttgattacttaattcgccacagcgatgaaaca
gagcaagcttaa

DBGET integrated database retrieval system