KEGG   Peptoniphilus harei: NCTC13077_00111Help
Entry
NCTC13077_00111   CDS       T05838                                 

Gene name
ung
Definition
(GenBank) Uracil-DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
phar  Peptoniphilus harei
Pathway
phar03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:phar00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    NCTC13077_00111 (ung)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:phar03400]
    NCTC13077_00111 (ung)
Enzymes [BR:phar01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     NCTC13077_00111 (ung)
DNA repair and recombination proteins [BR:phar03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     NCTC13077_00111 (ung)
 Prokaryotic type
     NCTC13077_00111 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UDG
Motif
Other DBs
NCBI-ProteinID: VEJ33193
LinkDB All DBs
Position
1:120998..121669
Genome map
AA seq 223 aa AA seqDB search
MKEILKNDWQDILEEEFEKDYYKDLRKLLIEEYKNYEIFPKAQDIFNAFHYTSYKDLKVL
ILGQDPYHNVGQAHGLAFSVKEGVAIPPSLRNIYKELNSDLGIEIPQTGYLKSWAEQGIM
LLNTTLTVRAHQPMSHSKIGWEIFTNAVIEKISEKEDPVVFILWGNHAKARKKFIKPGNH
LIIEGVHPSPLSASRGFFGSRPFSRANEFLKEKGVTPPTWEIK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
gtgaaggaaattttaaaaaatgattggcaagacattttggaagaagagtttgaaaaggac
tactacaaggaccttagaaaacttttaattgaagaatataaaaattatgaaatatttcca
aaggctcaggatatttttaacgcctttcactacacttcttacaaggacctaaaagttttg
atcttgggtcaggacccctaccacaatgtgggccaggctcatggacttgccttttctgtc
aaggaaggtgtggcaattccaccctcacttagaaatatttataaggaactaaattctgat
ttgggaatagaaattccacaaacaggttacttaaaatcatgggcagaacaggggataatg
cttcttaataccaccctaacagttagggcccaccaacccatgagccactcaaaaattgga
tgggagatcttcaccaacgcagtcatagaaaaaattagcgaaaaagaagacccagtagtt
tttatactatggggcaaccacgccaaggcccgcaagaagtttataaagcctggcaaccac
ctcatcattgaaggagtccatccatctccactttcagcatcgaggggattttttggatca
aggcccttctcaagagccaatgaatttttaaaagaaaagggagtgacaccaccaacttgg
gaaataaaataa

DBGET integrated database retrieval system