KEGG   Peptoniphilus harei: NCTC13077_01409Help
Entry
NCTC13077_01409   CDS       T05838                                 

Gene name
ahpF
Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
phar  Peptoniphilus harei
Brite
KEGG Orthology (KO) [BR:phar00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    NCTC13077_01409 (ahpF)
Enzymes [BR:phar01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     NCTC13077_01409 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_oxidored HI0933_like NAD_binding_8 FAD_binding_2 DAO Thi4 FAD_binding_3 FMO-like K_oxygenase AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: VEJ35122
LinkDB All DBs
Position
1:complement(1444693..1446216)
Genome map
AA seq 507 aa AA seqDB search
MLDQNLKNQVKGYLQLLEREVVISISLDDSENSKKLRDFVDEVASITDKIKLEEADLKFK
PSFSLSSGSVSGVTFAGLPLGHEFESFILALLQVGGRPPKIDDKTRERIEALDEEMEFET
MVSLSCHNCPEVVQALNIMAVLNPKIRHTMVDGSVFTDYVEDLGVLAVPTTYLKDEVFNN
GKVSLDEILNKISHEEVDLKLEEKPVFDSLIIGGGPGGATAAIYGARKGIKVGLVAEEFG
GQVKETLSIENITGIEYTEGPKYMDDVKVHLDKYKVDIIEGASVTDIVEGKPLKVITNKG
ELFAKTLIIATGAKWRLIGIPGEIEFRNKGVAYCTHCDGPLFKGKKVTVIGGGNSGIEAA
IDLASLAKEVLVLEFLPKLKADKVLQDKLKEFKNVRIVTNAETQALTGEKVLEKISYKDR
VSGEVIEENTEGCFIQVGLVPMTEWADMVEKNSRGEIIVDEFGATSLEGVYGAGDCTNSA
FKQIIIAEGSGATAALGAYNYLMTRGN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttagatcaaaatttaaaaaatcaggttaagggatatttacaacttctcgagagagag
gttgtaatttctattagccttgatgattcagaaaattctaaaaagttaagagactttgtt
gatgaagtggctagcattacagataagattaagctagaggaagctgacttaaagtttaag
ccaagctttagcctttcatctgggtctgtaagtggagttacttttgctggtcttcctcta
ggtcatgagtttgagtcctttatccttgccctcttacaagttggaggtcgtcctccaaag
attgatgacaagactagggagaggatagaagctcttgatgaggaaatggaatttgaaact
atggtgagtctatcctgccacaattgccctgaagttgttcaggctttaaacattatggca
gtcttaaatccaaagattaggcacacaatggttgatgggtctgttttcacagactatgta
gaggaccttggggtcttggcggtgccaacaacttatctaaaggatgaagtctttaacaat
ggtaaggtttctttagatgaaatcttaaacaagattagccatgaggaagtggacttaaag
ctagaagaaaaacctgtttttgacagtcttattattggtggaggccctggtggggcaaca
gctgccatctatggagcgagaaagggaataaaagttggacttgtggctgaagaatttggc
ggtcaggttaaggaaactctttcaatagaaaatattactgggattgaatacacagaggga
ccaaaatacatggacgatgtgaaggttcatctagacaagtataaagttgatattattgaa
ggtgcatctgtaactgatattgtagaaggtaaacctttaaaagttattactaataaggga
gagctatttgccaagactttaataattgcaactggagccaagtggaggctaattggcatt
cctggagagatagaatttaggaacaagggcgttgcctactgcactcactgtgacggacca
ctctttaagggtaagaaggtcacagtaattggtggaggaaactctggtatcgaagctgca
attgatcttgctagccttgccaaggaagtcttagtcctagaattcttgccaaaactaaag
gcagacaaggttcttcaagacaagctaaaagaatttaaaaatgtgagaatagttactaat
gcagaaactcaagccttgactggagaaaaagttttggaaaaaatttcttacaaggacagg
gtaagtggcgaagtcatagaagaaaatactgaaggctgctttatccaagttggacttgta
ccaatgactgagtgggcagacatggtagaaaaaaattctcgtggagaaataattgtagat
gagtttggggctacaagccttgaaggagtttatggagcaggggactgcactaactcagcc
ttcaaacaaatcataatagcagagggttcaggtgcgacagcagcccttggcgcctacaat
tatttaatgactaggggaaattaa

DBGET integrated database retrieval system