KEGG   Proteus hauseri: PH4a_06585
Entry
PH4a_06585        CDS       T05854                                 

Definition
(GenBank) oligopeptidase A
  KO
K01414  oligopeptidase A [EC:3.4.24.70]
Organism
phau  Proteus hauseri
Brite
KEGG Orthology (KO) [BR:phau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:phau01002]
    PH4a_06585
Enzymes [BR:phau01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.70  oligopeptidase A
     PH4a_06585
Peptidases and inhibitors [BR:phau01002]
 Metallo peptidases
  Family M3
   PH4a_06585
SSDB
Motif
Pfam: Peptidase_M3 Transglut_core2 Shugoshin_C
Other DBs
NCBI-ProteinID: QAV23033
UniProt: A0A410X935
LinkDB
Position
1447553..1449595
AA seq 680 aa
MSNPLVSTTGLPAFSQIKPEHVVPALKEILATYRATVEKLLADNTQFSWDNLCQPLAEAG
DKLARAWSPVSHLNSVKNCTELREAYEQSLPLLSEFSTWMGQHEGLYQAYKSIKESADFN
HLTQPQKKAIENALRDFELSGIGLPKEKQQRFGEISARMSELGAKFGNNVLDATMGWSKL
ITDVNDLAGMPQSAIDAAKAIAESKEQEGYLLTLDMPSYLPVMTYADNRELRKEMSIAYS
TRASDQGPNAGQWDNSEIMAEILALRHELAQLLGFKNYAEKSLATKMAQSPEQVLNFLTD
LAQRAHSQGEAELAELTQFAKEHYGVDKLEPWDLAYYSEKQKQHLFSIDDEQLRPYFPEQ
RALSGLFEVVHRIYGLTAKERKDIDTWHDDVRFFELYDESNTLRGSFYLDLYAREHKRGG
AWMDDCIGRMRHADGSLQNPVAYLTCNFNKPVGDKPALFTHNEVTTLFHEFGHGLHHMLT
QIDTADVAGINGVPWDAVELPSQFMENWCWEPEALTFISGHYETGEPLPQAMLENMLTAK
NYQSAMFVLRQLEFGLFDFRLHAEYSPEKGARIMEILNSVKEKVSVVPSAPWARFPHAFS
HIFAGGYAAGYYSYLWADVLAADAFSRFSEEGIFNRETGQSFLDNILTRGGSEEPMELFK
RFRGREPKLDAMLKGYGIKG
NT seq 2043 nt   +upstreamnt  +downstreamnt
atgtcaaatccattagttagcacaacgggattacctgcattctcccaaataaaaccagaa
cacgttgtacctgcactgaaagaaattttagcaacctatcgcgcaactgttgagaaatta
ctcgctgacaatactcaatttagctgggataacctttgccagcctttagctgaagcgggc
gataaacttgcccgagcatggtctcctgttagtcatttaaattcagtaaaaaactgtact
gaattgcgcgaagcttatgaacaaagtttaccattactctctgaatttagtacttggatg
ggtcaacacgaagggttatatcaagcctataaatcaataaaagaaagtgctgattttaat
cacctcacccaaccacagaaaaaagccatagaaaacgcactacgcgattttgagctatct
ggtattggcttaccaaaagaaaaacaacaacgttttggtgaaattagtgcgcgtatgtca
gagcttggcgcaaaatttggtaataatgtgttagatgcaacaatgggttggtctaaatta
attaccgatgtaaatgacttagcagggatgccacaaagtgctattgatgcagccaaagct
attgcagagtctaaagaacaagagggctatttattaacacttgatatgcctagttatctg
cctgtaatgacttacgctgataaccgcgaacttagaaaagagatgagcatcgcttatagc
acgcgagcctctgatcaaggccctaacgcaggtcagtgggataacagtgagattatggct
gaaatcttagcgttacgtcatgaattagcacagttgttaggttttaaaaactacgctgaa
aaatcactagcaactaaaatggcacaatcaccagagcaagtccttaatttcttaaccgat
ttagcacaacgcgctcattctcaaggtgaagcagagctcgctgaattaacgcaatttgcc
aaagaacactatggtgttgataagttagaaccttgggatctggcttattacagtgaaaaa
caaaaacaacatctattttccatcgatgatgaacaattacgtccttattttcctgaacaa
cgtgcgctcagtggattatttgaagtagttcatcgtatttatggtttaaccgctaaagaa
cgcaaagatatcgacacatggcatgatgatgtgcgtttctttgagctttatgatgagagc
aataccctacgcggcagtttctatctcgatttatatgcccgtgaacataagcgtggcggt
gcatggatggatgattgtattggcagaatgcgtcatgctgatggctcactacaaaaccca
gttgcttatctcacctgcaatttcaataaacctgtaggcgataagcctgcactcttcact
cataatgaagtcacaacgctattccatgaattcggtcatggcttacatcatatgctaacg
caaattgataccgctgatgttgcaggtattaatggtgtgccttgggatgcagtcgaattg
ccaagccaatttatggaaaactggtgctgggagcctgaagcattaacctttatttctgga
cattacgaaactggtgaacctctgccacaagcaatgttagaaaatatgttaacagcaaaa
aattatcaatccgcaatgtttgtgttacgccaattagaatttggtctatttgatttccgt
ttacacgctgagtactcaccagaaaagggggctcgtattatggaaattttaaatagcgtg
aaagagaaagtctctgtggtaccttctgcaccgtgggcacgtttccctcatgcctttagt
catatctttgcaggcggttatgctgcgggctattacagctacttatgggcggatgtttta
gctgcggatgcattctctcgtttctctgaagaaggtatttttaaccgcgaaacaggccaa
tcattccttgataacattttaacgcgtggtggttcagaagaaccaatggaactatttaaa
cgcttccgtggtcgtgagcctaagcttgatgcaatgctcaaaggctatggtattaaaggg
taa

DBGET integrated database retrieval system