KEGG   Proteus hauseri: PH4a_06655Help
Entry
PH4a_06655        CDS       T05854                                 

Definition
(GenBank) carboxypeptidase/penicillin-binding protein 1A
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
phau  Proteus hauseri
Pathway
phau00550  Peptidoglycan biosynthesis
phau01100  Metabolic pathways
phau01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:phau00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    PH4a_06655
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    PH4a_06655
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phau01003]
    PH4a_06655
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:phau01011]
    PH4a_06655
Enzymes [BR:phau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     PH4a_06655
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     PH4a_06655
Glycosyltransferases [BR:phau01003]
 Polysaccharide
  Bacterial polysaccharide
   PH4a_06655
Peptidoglycan biosynthesis and degradation proteins [BR:phau01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   PH4a_06655
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly PCB_OB Transpeptidase
Motif
Other DBs
NCBI-ProteinID: QAV23046
UniProt: A0A410X8Y1
LinkDB All DBs
Position
complement(1464936..1467470)
Genome map
AA seq 844 aa AA seqDB search
MKFLKYFFIFVFACIILGAASIYGMYKYVEPELPDVATLKDVRLQTPMQVFSADGELMAQ
YGEKRRLPLTLQEMPPQLINAFIATEDTRFREHHGIDPIGISRAVMVALTSGQASQGAST
ITQQLARNFFLTPEKKLMRKVKEAFLAIRIEKELTKDEILELYLNKIYLGNRAYGVGAAA
YVYFGKSVHDLSLSEMAVIAGLPKAPSTLNPLYSYDRAFKRRNIVLQRMFEENYITRAQY
ESAKAEPIVAKYHAPQIDFSAPYLTEMVRMEMYERYGENAYTDGYKIYTTVIRKDQLSAE
KALRDNVIDYDMRHGYRGAQEVLWSAGQTPWDSKAISEKLKGIQTYGPLIPAVVLSADAK
EANVVLKNGDTISLDLKAVRWARKFISDTSQGATPSKVDAVVHAGEQIWVRQDNANNWVL
GQLPGVNAAFVALNPLDGSIIALVGGFDFEISKFNRVSQSLRQVGSNIKPFLYAAALDKG
LTLSTLLNDLPISRWDAGAGTDWRPKNSPPTYAGPIRLRQGLGQSKNVVMVRAMRAMGVD
YAADYLLRFGFPNQNIDRTESLALGSPSFTPMQMVRGFAVMANGGYLIEPYFIQRIENAE
GEVLFTAKPKIACPECTDIPVIYGDTNRSIALSDDYMENVAQSRAAQPSNVAPDIELEAA
PLAETVQESQYAPHVISTPLAFLMHDALRTNLVGEPGWSGTGWRALRDLKRQDIGGKTGT
TNSSKDAWFSGYGANIVATAWIGFDDSSRNLGRTAASGGEAGAKTAQPIWNDFMKVALDG
VPVNMMPAPEGIVAVQIDRKTGKLAGDGPSMKEYFIEGTQPTERAKNEVGTQIFEDNGES
NELF
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
gtgaagttcttaaaatattttttcatcttcgtttttgcttgcataattttgggagcagcc
tcgatatacggtatgtataagtatgttgagcctgagcttccagatgtagcaacattaaaa
gatgttcgtctacaaaccccaatgcaggtttttagtgcagacggagagttgatggcacaa
tacggtgaaaagcgccgtttacctctgacgttgcaggaaatgccacctcagttaattaat
gcttttattgcgacagaagatactcgttttcgtgaacaccatggtattgatccaataggt
atttctcgtgcggtaatggtcgcgttaacctcaggacaagcatcacaaggtgctagtacg
attacacagcaattagctcgaaatttctttttaacaccagaaaagaaattaatgcgaaaa
gttaaagaagcgttcttagctattcgtattgaaaaagagttaactaaagatgaaatttta
gagctttatctcaataaaatttatcttggtaaccgtgcttatggggtgggagctgctgct
tatgtctattttggtaaaagtgtacatgatcttagcttaagtgagatggcagtgattgca
gggttacctaaggcgccttctacgctaaatcctctctattcttatgatcgtgcatttaaa
cgacgtaatattgttttacaacgtatgtttgaagagaactatattactcgagcacagtat
gagagtgctaaagcagaacctattgttgctaaatatcatgcacctcaaattgatttttct
gcgccatatttgactgaaatggttagaatggaaatgtatgaacgctatggtgaaaatgct
tatactgatggctataaaatctacaccacagtgatacgaaaagatcagctttcagcagaa
aaagcgttacgagataacgttattgattatgatatgcgtcatggttatcgcggagcacaa
gaagtactttggagtgcagggcaaacgccttgggatagcaaagcaattagcgaaaaatta
aaaggaattcagacttatggtccgcttattcctgccgttgtgttatcggctgatgctaaa
gaagccaacgttgtattaaaaaacggtgacaccatttcgcttgatttaaaagcagtacgt
tgggcgcgtaaatttatttctgatacatctcaaggtgctacaccgtctaaagtagatgca
gttgttcatgcgggtgagcaaatatgggttcgccaagataatgcaaataactgggtttta
gggcaactaccaggtgtaaatgcggcttttgttgcattgaatccgcttgatggcagtatc
attgcgctggttggtggttttgattttgagataagtaaatttaaccgtgtttctcaatca
ttacgtcaagtcggttcaaatattaaacctttcttatatgcagcagcattagataaaggt
ttaaccttatcaacgcttcttaatgacttacctattagtcgatgggatgcaggtgcgggc
accgattggcgtcctaaaaactcacctccaacctatgcggggcctattcgtttacgccaa
ggattaggtcagtctaaaaacgttgttatggtacgagccatgcgtgcaatgggggtggat
tatgccgctgattacttattacgatttggctttcctaatcaaaatatcgatagaactgag
tcgttagcattaggttctccgtcatttacgccaatgcagatggttcgtggttttgccgtt
atggctaatggtggttatttaatcgagccttactttattcaacgtattgaaaacgctgaa
ggtgaagtgttatttaccgctaaacctaaaatcgcctgtcctgaatgcaccgatattcca
gttatttatggtgataccaatcgttctatcgcattatctgatgattacatggaaaatgta
gcgcaatctagagccgctcagccttcaaatgtggcaccagacattgagttagaagctgca
ccattagctgaaacagtacaagaaagccaatatgcacctcatgttatcagtacacctctt
gccttcttaatgcatgatgcattaagaacgaaccttgttggtgaaccgggttggtcggga
acaggatggcgagctttgcgtgatctgaaacgacaagatattggtggcaaaacaggtacc
acaaatagctctaaagacgcatggttctctggatatggtgccaatattgtcgcaaccgca
tggattggttttgatgatagcagtcgtaatttagggcgcactgcagcaagtggcggagag
gcgggcgctaaaaccgcacaacctatttggaatgactttatgaaagtcgcacttgatggt
gttcctgtgaatatgatgccagcaccagaaggtatcgttgcagttcaaattgataggaaa
acaggtaagttggctggcgatggcccttcaatgaaagaatattttattgaaggaacacaa
ccaacggaaagagcaaaaaacgaagtgggtacacagatttttgaagataacggcgaatct
aatgagttattttaa

DBGET integrated database retrieval system