KEGG   Proteus hauseri: PH4a_12185Help
Entry
PH4a_12185        CDS       T05854                                 

Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
phau  Proteus hauseri
Pathway
phau00020  Citrate cycle (TCA cycle)
phau00190  Oxidative phosphorylation
phau00650  Butanoate metabolism
phau01100  Metabolic pathways
phau01110  Biosynthesis of secondary metabolites
phau01120  Microbial metabolism in diverse environments
phau01130  Biosynthesis of antibiotics
phau01200  Carbon metabolism
Module
phau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:phau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PH4a_12185
   00650 Butanoate metabolism
    PH4a_12185
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PH4a_12185
Enzymes [BR:phau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PH4a_12185
    1.3.5.4  fumarate reductase (quinol)
     PH4a_12185
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C GIDA Pyr_redox_2 HI0933_like Thi4 FAD_binding_3 DAO FAD_oxidored Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: QAV24050
UniProt: A0A410XBJ3
LinkDB All DBs
Position
2679600..2681366
Genome map
AA seq 588 aa AA seqDB search
MNLPVREFDAVVIGAGGAGMRAALQISQMGLSCALISKVFPTRSHTVSAQGGITVALGNT
HEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFG
GQSRNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYSLDLVKNQDGDIVGC
TAICIETGEVVYFKANATILATGGAGRIYQSTTNAHINTGDGVGMAVRAGVPLQDMEMWQ
FHPTGIAGAGVLVTEGCRGEGGYLLNKDGERFMERYAPNAKDLAGRDVVARSIMIEIREG
RGCDGPWGPHAKLKLDHLGKEVLESRLPGILDLSRTFAHVDPIKEPIPVIPTCHYMMGGI
PTKVTGQAIRVNAQGKDEVIPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRSAGVHLK
ESLMEQGTMREASDSDIDAALTRLNRWENNRSGEDPVEIRKALQSCMQHNFSVFREGDAM
AKGLEELKVIRERLQNARLDDNSSEFNTQRIECLELDNLMETAYATAVSANFRTESRGAH
SRFDFPERDDANWLCHTLYQPQTETMTRREVNMQPKLREAFPPKVRTY
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatctgccagtaagagagtttgacgcagtcgttattggggctggtggtgcgggaatg
cgcgctgctttacagatttcccaaatgggactgtcatgtgcactaatatctaaagtattt
cctactcgttctcatactgtttccgcccaaggtggtattactgtcgcattaggtaataca
cacgaagataattgggaatggcatatgtacgataccgttaaaggctccgattatattggt
gatcaagacgccattgagtacatgtgtaaaactggccccgaagcaattttagagctagag
catatggggctgccattttctcgtcttgatgatggtcgcatttatcaacgtccttttggt
ggtcaatctcgaaattttggtggtgaacaagccgctcgaactgctgcggctgctgaccgt
acagggcacgcattattacacaccctctatcagcaaaatttaaaaaatcatacaactatc
ttctctgaatggtattcactagatttagtgaaaaaccaagatggcgatattgtcggttgt
actgcaatttgtattgaaacaggcgaagtggtttatttcaaagcaaatgcaactattctg
gcaacaggtggcgcaggtcgcatctaccaatcaaccactaatgcacatatcaatacaggt
gatggcgttggtatggcggttcgtgccggagttcctttgcaagatatggaaatgtggcaa
ttccacccaacgggtattgcgggtgcgggggtattagttacagaaggttgccgtggtgaa
ggtggatatctattaaataaagatggcgaacgctttatggaacgctatgcacctaatgcc
aaagatctcgccggtcgagatgttgtcgctcgttcaattatgattgaaattcgcgaaggt
cgtggttgtgatggtccttgggggcctcatgctaaattgaaactcgatcatctgggtaaa
gaagttcttgagtctcgtttacccggtattcttgacctttctcgtacctttgctcacgtt
gacccaattaaagagccaattccagttattcctacttgtcactatatgatgggtggtatt
ccaacgaaagtaacgggacaagctattcgcgtaaatgcgcagggtaaagatgaagttatc
cctggattatttgctgtaggcgaaattgcttgtgtttctgttcatggtgcaaaccgttta
ggtgggaattccttgctcgacttagttgtttttggccgttcagccggggttcacttaaaa
gagtcactgatggaacaaggcacaatgcgcgaagccagtgattcagatattgacgctgca
ttaacacgcttaaatcgttgggaaaacaatcgttctggtgaagacccagtcgaaatccgt
aaagcattgcaatcttgtatgcaacataacttctctgtattccgtgaaggtgatgcaatg
gcaaaaggtctggaagagcttaaagttattcgtgagcgcttacagaatgcacgacttgat
gataattcaagcgaatttaatacccaacgtattgagtgcttagaattagataacttgatg
gaaacagcgtatgccactgcggtatctgctaatttccgtacagaaagtcgtggtgcccat
agccgtttcgatttccctgaacgtgatgatgcgaactggttatgtcatacgttatatcag
ccgcaaaccgaaacaatgacacgacgtgaagtcaatatgcagccgaaactgcgtgaggct
tttcctccaaaagtgcgtacatattaa

DBGET integrated database retrieval system