KEGG   Proteus hauseri: PH4a_12190Help
Entry
PH4a_12190        CDS       T05854                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase iron-sulfur subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
phau  Proteus hauseri
Pathway
phau00020  Citrate cycle (TCA cycle)
phau00190  Oxidative phosphorylation
phau00650  Butanoate metabolism
phau01100  Metabolic pathways
phau01110  Biosynthesis of secondary metabolites
phau01120  Microbial metabolism in diverse environments
phau01130  Biosynthesis of antibiotics
phau01200  Carbon metabolism
Module
phau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phau_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:phau00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PH4a_12190 (sdhB)
   00650 Butanoate metabolism
    PH4a_12190 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    PH4a_12190 (sdhB)
Enzymes [BR:phau01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     PH4a_12190 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     PH4a_12190 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: QAV24051
UniProt: A0A410XBI2
LinkDB All DBs
Position
2681401..2682117
Genome map
AA seq 238 aa AA seqDB search
MKLEFSIYRYNPDVDNAPHMQDYTLEAPEGRDMMLLDALIQLKEKDPTLSFRRSCREGVC
GSDGLNMNGKNGLACITPISSLHRGSKKIVIRPLPGLPVIRDLIVDMTQFYTQYEKIRPY
LLNDDKNPPARENLQSPEQRAKLDGLYDCILCACCSSSCPSFWWNPDKFIGPAGLLAAYR
FLIDSRDTETESRLDDLNDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLKRSA
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttgaattttcgatttatcgttacaaccctgatgttgacaatgcgccgcatatg
caagattacaccctagaagcacctgaagggcgtgacatgatgctattggatgcattaatt
cagctaaaggaaaaagatcctactttatcgttccgtcgttcttgtcgtgaaggggtctgt
ggttctgatggtttgaatatgaacggtaaaaatggtttggcttgtatcacacctatttca
tctttacacagaggaagtaagaaaattgtgatcagaccgttacccggtttacctgtgatc
cgtgatttaatagtagatatgactcagttctacactcaatatgagaagatccgtccttat
ttacttaatgatgacaaaaatcctcccgctcgtgagaacttacagtcaccagaacaacgt
gcgaagcttgatggtctttatgattgtatactttgtgcttgttgttcaagctcttgccca
tcattctggtggaatccagataagtttattgggcctgcgggactattagctgcatatcgt
ttcttgattgatagtcgtgatacagaaacagaatctcgtcttgatgatcttaacgatgct
ttcagtgttttccgctgtcacggcattatgaattgtgtcagcgtatgtcctaaaggactt
aatccgacaaaagcaataggtcacattaagtcaatgttgttaaaacgtagtgcataa

DBGET integrated database retrieval system