KEGG   Proteus hauseri: PH4a_14845Help
Entry
PH4a_14845        CDS       T05854                                 

Definition
(GenBank) superoxide dismutase [Cu-Zn] SodC1
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
phau  Proteus hauseri
Brite
Enzymes [BR:phau01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     PH4a_14845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: QAV24539
UniProt: A0A410XD07
LinkDB All DBs
Position
3244318..3244845
Genome map
AA seq 175 aa AA seqDB search
MKLTPWLLSGFLFTSIAASAATLDVTLKEALLTGEGNDIGVVTITETDYGLLFTPKINGL
APGIHGFHVHANGSCEPDMKEGKPVPALKAGGHLDPENKDTHLGPYNKDGHLGDLPGLVV
SDKGVADYAVLAPRLTKLEQIKDKALMIHMGGDNYSDHPEVLGGGGARMACGVIK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgacaccttggttattatcaggttttttatttacctcaatagcagcaagtgca
gccacattagatgttacgttaaaagaagcattacttacgggagaaggaaatgatatcggt
gttgttactatcactgaaacagattatggcttgctatttacgcctaaaattaatggatta
gcacctggcattcatggttttcatgttcatgctaacggctcatgtgagcccgatatgaaa
gagggtaaacctgttcctgcgttaaaagcgggtggtcatttagatccagaaaataaagac
acgcatttaggtccttataataaagatggacacttgggtgatttacctggtttggttgtg
agtgataaaggtgtggctgattatgctgtattagcgccaagactcactaaattggaacag
ataaaagataaagcacttatgatccatatggggggtgataactattctgatcaccctgaa
gtattaggcggcggcggtgctagaatggcgtgtggtgtaattaaatag

DBGET integrated database retrieval system