KEGG   Proteus hauseri: PH4a_15885Help
Entry
PH4a_15885        CDS       T05854                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
phau  Proteus hauseri
Brite
KEGG Orthology (KO) [BR:phau00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    PH4a_15885
Enzymes [BR:phau01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     PH4a_15885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored Thi4 FAD_binding_3 DAO NAD_binding_8 AlaDh_PNT_C K_oxygenase Lycopene_cycl Glutaredoxin NAD_binding_7 FMO-like
Motif
Other DBs
NCBI-ProteinID: QAV24735
UniProt: A0A410XDS4
LinkDB All DBs
Position
complement(3464674..3466239)
Genome map
AA seq 521 aa AA seqDB search
MLDNNLKAQLKAYLERLTQPVELVATLDDSKHSVEIQSLLKEIEILSDKVTYREDNSANV
RKPSFLITNPGKETGVRFAGSPLGHEFTSLVLALLQTGGHPSKEAQDLLEQIRQLDGEFH
FETYYSLSCHNCPDVVQALNLMAILNPKITHTAIDGGMFQNEIQERNVMGVPAVFLNGNE
FGQGRMTLADIVNKVDSNAEKRAAEALNKKDVFDVLIVGSGPAGASAAVYSARKGLNTGL
IGERFGGQVLDTVDIENYISVPKTEGAKLAGALKAHVDDYQVDVIDSQTVSRLIPGVLEG
DLHQIETASGATLKTRSLIIATGARWRNMNVPGENEYRTRGVTYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGLVEHVTVLEFAPEMRADAVLQKKLRSLSNVEIILNAQTTEVYGD
GTKLTGLKYKDRTNDSMHDIALAGIFVQIGLLPNTQWLEGTVERNKMGEIIVDARGETNI
KGVFAAGDCTTVPYKQIIIAAGEGAKASLSAFDYLIRTTAK
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttagataataatttaaaagctcaactgaaagcttatttagaacgattaacccagcca
gttgagttagtagcaacattagatgacagcaaacattctgttgaaattcaatctctatta
aaagagattgaaatattatccgataaagtgacttatcgtgaagacaatagcgccaatgtg
cgtaaaccatcttttcttatcaccaatccagggaaagaaacaggtgttcgttttgcaggt
tcgccactagggcatgaatttacatcattagtcttagcattactgcaaacaggtggtcat
ccatctaaagaagcacaagatttacttgaacaaattcgtcagttagacggtgagtttcat
ttcgaaacctattattcgctctcttgtcataactgcccagatgttgttcaggcattaaac
ttaatggcgattttaaatccgaaaatcacacacactgcgattgacggaggcatgttccaa
aatgaaattcaggaacgtaatgtgatgggcgttcctgctgtattcttaaatggtaatgag
tttggtcagggtcgtatgacactcgctgatatcgttaataaagtagatagtaatgcagaa
aaacgtgctgctgaggctttaaataagaaagatgtttttgatgttcttattgtcggtagt
ggtccagcaggtgcatcagcagcagtttattcagcacgtaaaggcttaaatacgggcctt
atcggtgagcgttttggtgggcaagttcttgatactgttgatattgaaaactatatttct
gtacccaaaacagaaggtgctaaacttgcaggtgcattaaaagcgcatgttgacgattat
caagtcgatgtaattgatagccaaactgttagtcgtttgatcccgggggttttagaaggt
gatttacaccaaattgaaactgcatcgggtgcgacattaaaaacacgtagcttaattatt
gcaacaggtgctcgttggagaaacatgaatgttcccggcgaaaatgagtatcgtactcgt
ggtgtaacttattgcccacactgcgatggtccattatttaaaggcaaaagagttgctgtt
attggtggtggtaactcaggtgttgaagccgctatcgatttagctggcttagtagagcat
gtcactgtattagaatttgcgccagaaatgagagcagatgccgtattacagaaaaaactg
cgtagcttaagtaatgttgaaatcattttaaatgcacaaacaacagaagtgtatggtgat
ggtactaaattaacaggacttaaatataaagatcgcactaatgattctatgcatgatatc
gctttagcgggtattttcgttcaaattggcttattacctaatacacagtggctagaaggc
actgttgagcgtaataaaatgggcgaaattattgttgatgctcgtggtgaaacgaatatt
aaaggtgtatttgcagcgggtgactgtacaaccgttccttacaagcaaatcattatcgca
gcaggagaaggtgctaaagcctcactcagcgcctttgattacttaattcgcaccactgca
aaataa

DBGET integrated database retrieval system