KEGG   Phenylobacterium sp. HYN0004: HYN04_06010Help
Entry
HYN04_06010       CDS       T05485                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
phb  Phenylobacterium sp. HYN0004
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N TrkA_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AWM77358
UniProt: A0A2Z3I0S5
LinkDB All DBs
Position
complement(1231219..1232301)
Genome map
AA seq 360 aa AA seqDB search
MRAVIRRNKQLVCDEVPDLTPGPGQILVRTLACGICGSDLHALHHMEHMMETATRASGGF
ASGFDPTADTVFGHEFCAEVLDHGPGSQKTIRAGSRVVSVPVTLTETGMESLGYSNRLPG
GFAERMLLTEAMVLEVPNGLPTDQAALTEPFAVGEHAVAMARLDPNSVCMVVGCGPVGLA
VIAALKARGHGPVVATDYSPRRRAAAEKLGADLVIDPSKESPHARWDSYGVPVQRAAQSM
ARMMGKSFGRAVVFECVGAPGILQTLIEASPAGAQIVVAGVCMETDKIEPAIAITKEMEL
TFVFGYTPDEFAHTLRQISEGIIDVSSVVTGKVGLAGVAEAFVTLGDPESHVKILVEPTR
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgccgtcatccgtcgcaacaagcagctcgtctgtgacgaggttccggacctgacg
ccgggccccgggcagatcctggtgcggaccctcgcctgcgggatctgcggctcagacctg
cacgccctccatcacatggaacacatgatggagacggccacccgcgcgagcggaggcttt
gcttcaggttttgaccccacggccgacaccgtcttcggacatgagttctgcgccgaggtg
ctggaccatggcccgggctcgcaaaagacgatccgggcggggtcccgcgtggtctcggtc
cccgtgaccctgacggagaccggcatggaatccctcggctactccaaccgtcttcccggt
ggattcgccgaacgcatgctcctgaccgaggccatggtcctggaggtgccaaacggcctt
ccgaccgaccaggcggccctcaccgagcccttcgccgtgggggagcacgccgtggccatg
gctcggctcgaccccaactctgtctgcatggtggtgggctgcgggcctgtgggcctggcg
gtcattgcggccctcaaggcccggggtcacggtccggtggtcgcgacggactattcgccg
cgccgtcgggccgcagccgaaaaacttggggccgacctggtcatcgatccctcgaaggaa
agcccgcacgcccgctgggacagctatggcgttcccgtgcagagggccgcccagtccatg
gcccggatgatgggcaagtcctttggccgcgccgtcgtctttgaatgtgtcggcgcccca
ggcatcctccagaccctgatcgaggcttcgcccgccggcgcccagatcgtcgtggccggc
gtctgcatggagaccgacaaaatcgagccagccatcgccatcaccaaggaaatggagctg
acctttgtctttggctacacgcctgacgagttcgcccacaccctgcggcagatctccgag
gggatcatcgacgtctcaagcgtggtgaccggcaaggtgggcctggccggcgtcgccgag
gccttcgtgaccctgggagatccggaatcccacgtgaagatcctggtcgaacctacaagg
taa

DBGET integrated database retrieval system