KEGG   Phenylobacterium sp. HYN0004: HYN04_06940Help
Entry
HYN04_06940       CDS       T05485                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
phb  Phenylobacterium sp. HYN0004
Pathway
phb00061  Fatty acid biosynthesis
phb00780  Biotin metabolism
phb01100  Metabolic pathways
phb01212  Fatty acid metabolism
Module
phb_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:phb00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    HYN04_06940 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    HYN04_06940 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:phb01004]
    HYN04_06940 (fabZ)
Enzymes [BR:phb01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     HYN04_06940 (fabZ)
Lipid biosynthesis proteins [BR:phb01004]
 Fatty acid synthase
  Component type
   HYN04_06940 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA 4HBT MaoC_dehydrat_N MaoC_dehydratas 4HBT_2
Motif
Other DBs
NCBI-ProteinID: AWM77524
UniProt: A0A2Z3I266
LinkDB All DBs
Position
complement(1446410..1446874)
Genome map
AA seq 154 aa AA seqDB search
MTAEVAATSIEIGEILARIPHRYPFLLVDRAEDYVPGESIVGIKAVTINEGFFQGHFPDY
PVMPGVLIVEAMAQTGAVLMSKTLDVDPRGKTILFASLDNCRFRHPVRPGDLLKLNVRVA
RARGGLFKFEGRAMVDDKVAAEAEFAAMLVETPQ
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcagaggtcgccgccacgtccatcgagatcggcgagatcctcgcccgcatcccg
catcgctaccccttcctcctggtggaccgggccgaggactatgtccccggcgagtcgatc
gtcggcatcaaggcggtcaccatcaacgagggcttcttccaggggcacttccctgactat
ccggtcatgcccggggtcctcatcgtcgaggccatggcccagaccggcgcggtgctgatg
tccaagaccctggacgtcgacccgcgtggcaagaccatcctcttcgcctccctggacaac
tgccggttccggcatccagtccggcccggagatctcctgaaactcaatgtccgggtcgcc
agggcccggggcgggctcttcaagttcgaggggcgcgccatggtggacgacaaggtcgcc
gccgaggcggagttcgccgccatgctggtggagaccccgcaatga

DBGET integrated database retrieval system