KEGG   Planococcus halocryophilus: BBI08_08465Help
Entry
BBI08_08465       CDS       T04473                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
phc  Planococcus halocryophilus
Pathway
phc00564  Glycerophospholipid metabolism
phc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:phc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    BBI08_08465
Enzymes [BR:phc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     BBI08_08465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 NAD_binding_8 FAD_binding_3 FAD_oxidored Pyr_redox_2 3HCDH_N GMC_oxred_N Pyr_redox
Motif
Other DBs
NCBI-ProteinID: ANU15498
UniProt: A0A1C7DW26
LinkDB All DBs
Position
complement(2546775..2548451)
Genome map
AA seq 558 aa AA seqDB search
MKFSSLHRNERYDQMKQSQLDVLVIGGGITGAGIALDAAVRGMDIAVVEMQDFAAGTSSR
STKLVHGGLRYLKQFEVKMVAEVGKEREIVYENGPHVTTPEWMLLPFYKGGTFGPLSTNV
GLRVYDFLAGVKKSERRKMLSKEETLRREPLLKKKELKGGGYYVEYKTDDARLTMEVMKK
AIEKGAMAMNYAKVKSFIYDNGKAVGVRVEDQIDGTIHEVFAKKIVNAAGPWVDTLRDKD
HSKFGKTLQLTKGIHLVFDGRRFPLKQAIYFDMPDGRMAFAIPRQGKVYVGTTDTVYEQD
IAHPTMTEEDRAYVLEAVDFMFPEVGITKEDVESSWAGLRPLIHEEGKDPSEISRKDEIF
ISDSGLISIAGGKLTGYRKMGESIVDLVAEQLQKEQGTKYPKISTKRLPVSGGEVGGSKG
LKTFRADRIHQAASMGLTADAMDMLVSRYGSNVDKVLHFYLQGLDAAAEAGLDPIVYAML
RYSMEYESAYKPIDFFIRRTGALFFDIHWVHAHKENVIAYMSKTLVWSEEQTEEYRAELE
GLLYEATHPVDVSSQSLN
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaattttcaagtttgcacagaaatgaacgatatgaccaaatgaaacaatcgcaatta
gatgttttagtcattggtggcggaattacaggtgcaggaattgcactagatgcggctgta
cgcggtatggatattgcggtagttgaaatgcaagattttgctgcaggcacaagtagccgc
tcaacaaaattggttcacgggggcttacgttacttaaaacaatttgaagtaaaaatggta
gcagaagttggcaaagagcgcgaaatcgtatatgaaaacggaccgcacgtaacgactcct
gaatggatgttattgccgttttataaaggtggaacattcggaccgctcagcacaaacgtt
ggtcttcgtgtttatgactttttagcaggtgttaaaaaatcagaacgccgcaaaatgtta
agtaaagaagaaacattgcgtcgcgagcctttattgaagaaaaaagaacttaaaggcgga
ggctattacgtagaatacaaaacagatgatgcgcgtttaacgatggaagtgatgaagaaa
gcgatcgaaaaaggcgcaatggcgatgaactatgcaaaagtgaaaagctttatttacgac
aatggcaaagcagttggcgtacgtgtcgaagatcagattgatggcaccattcatgaagtg
tttgcgaaaaaaattgtcaatgcggctggtccgtgggttgatacattgcgcgacaaagac
cattcgaaattcggtaaaactttgcaattgacgaaaggcattcacttagtgtttgatggc
cgtcgtttcccattaaaacaagccatttactttgatatgccggacggccgtatggcgttt
gcaattccacgccaaggaaaagtttatgtcggtacaacagatacagtgtacgaacaagat
atcgctcacccaacgatgacagaagaagatcgtgcttatgtcttggaagctgtagacttt
atgttccctgaagtgggaattacaaaagaagatgttgagtcaagctgggctggattgcgt
ccactgattcacgaagaaggaaaagatccatctgaaatttcacgaaaagatgaaatcttc
atttcagattctggtttaatttcgattgcgggtggtaaattgactggttaccgtaagatg
ggggaaagcattgtcgatcttgtggcagaacaattacaaaaagaacagggaactaagtat
ccgaaaatctcaacaaaacgcttgccagtttccggtggcgaagtgggcggatcaaaaggt
ctaaaaacgttcagagctgaccgtattcaccaagcggctagcatgggactgacggctgac
gcaatggatatgcttgtcagtcgttatggttcaaacgttgataaagtcctacatttctat
ttacaagggttagatgctgcagcagaagctggactcgatccgattgtttatgcgatgttg
cgttattcaatggaatacgaatcagcgtacaaaccaatcgatttctttatccgtcgtaca
ggtgcgttgttctttgatattcattgggtacatgcacataaagaaaatgtcatcgcttat
atgagcaaaacgctcgtatggagcgaagaacaaactgaagagtaccgtgctgaattggaa
ggcttgctttatgaagcaacgcatccggttgacgtatcttctcaaagcttaaactaa

DBGET integrated database retrieval system