KEGG   Planococcus halocryophilus: BBI08_08470Help
Entry
BBI08_08470       CDS       T04473                                 

Definition
(GenBank) glycerol kinase
  KO
K00864  glycerol kinase [EC:2.7.1.30]
Organism
phc  Planococcus halocryophilus
Pathway
phc00561  Glycerolipid metabolism
phc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BBI08_08470
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phc04147]
    BBI08_08470
Enzymes [BR:phc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     BBI08_08470
Exosome [BR:phc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BBI08_08470
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: ANU13880
UniProt: A0A1C7DQH8
LinkDB All DBs
Position
complement(2548691..2550193)
Genome map
AA seq 500 aa AA seqDB search
MSKDYILSIDQGTTSSRAVLFNHNGEIVETGQQEFQQFFPKPGWVEHDANEIWTSVLACM
AEVLRKSDISPTQIAGIGITNQRETTVVWDRHTGKPIYKAIVWQSRQTDGICNELKDQGL
NELFRNKTGLLIDAYFSGTKVKWILDNVEGAREKADNGDLMFGTMDTWLVYKLSGGKAHV
TDYSNASRTLMYNIFDLEWDQELLDILTVPKSMLPEVHQSSEVYANTVDYHFFGHEVPIA
GIAGDQQAALFGQACFEKGMAKNTYGTGCFMLMNTGEEGVKSEHGLLTTLAWGVDGKVEY
ALEGSIFVAGSAIQWLRDGLKIIKNAPESENYAMEVESTDGVYMVPAFVGLGTPYWDTDA
RGAVFGLTRGTTKAHFIRATLESLAYQTKDVVDVMIEDAGIELKTLRVDGGAVANDLLMQ
FQSDILDVPVERPVVQETTALGAAYLAGLAVGFWKDKEEIAKQWKVDKTFTRDMSTEDGE
KLYEGWKQAVAATRLFKPEK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
ttgagtaaagactatattttatctatcgaccaaggtacgacaagttcacgtgcggtattg
tttaatcacaatggtgaaatcgttgaaactggccagcaggaatttcagcaattctttccg
aagccaggctgggtagagcatgatgcaaatgaaatctggacatctgttttagcgtgtatg
gcagaagtattacgcaaatcggatattagtccaactcaaattgcgggtattggtatcaca
aaccaacgtgaaacaacagtggtttgggatcgtcatacaggcaagccgatttacaaagca
atcgtttggcaatcgcgtcaaactgacggaatttgtaatgaattaaaagatcaaggtttg
aacgaattattccgtaataaaaccggtcttttaatcgatgcttacttctctggaacgaaa
gtgaaatggattcttgataatgttgaaggtgcacgtgaaaaagcggacaatggcgacttg
atgtttggaacgatggacacatggttggtttataaattgtcaggtggtaaagcacacgtt
acagattacagtaatgcatcacgtacattgatgtataatattttcgatttagaatgggat
caggaattattagatattcttactgtaccgaagagcatgttgccagaagtgcatcaatca
tctgaagtttatgcaaacacagtggattatcatttctttggtcacgaagtaccgattgcc
ggtattgccggtgaccaacaagctgccttattcggtcaagcttgctttgaaaaagggatg
gcgaaaaatacttacggaactggttgcttcatgttgatgaacacgggtgaagaaggtgtt
aaatctgaacatggcttgttgacgactttggcttggggcgttgatggcaaagtagaatac
gcacttgaaggtagtattttcgtggccggttcagctattcaatggttgcgtgatggtttg
aaaatcattaaaaatgctcccgagagtgaaaactatgcaatggaagttgagtcgacagac
ggcgtatatatggttcccgcatttgttggacttggaacgccttactgggatacagatgca
cgtggtgcagtgttcggcttaacacgcggtacaacgaaagctcactttatccgtgcaaca
ctcgaatcactcgcatatcagacaaaagacgttgtagatgttatgattgaagatgcagga
atcgaactgaaaaccttgcgtgttgatggtggagcagttgcaaatgatttgttaatgcag
ttccaaagtgatattctagatgtaccggtagaacgtccagttgttcaggaaacaacagca
cttggtgcggcttacttagctggactggcagttggattctggaaagacaaagaagaaatc
gctaagcaatggaaagtcgataaaacctttacacgtgacatgtcgacagaagatggcgaa
aaactttatgaaggctggaaacaagcggtagcagcaacacgattattcaaacccgaaaaa
taa

DBGET integrated database retrieval system