KEGG   Planococcus halocryophilus: BBI08_09295Help
Entry
BBI08_09295       CDS       T04473                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
phc  Planococcus halocryophilus
Pathway
phc00240  Pyrimidine metabolism
phc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:phc00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    BBI08_09295
Enzymes [BR:phc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     BBI08_09295
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK AAA_22 UvrD-helicase IMPDH Terminase_6
Motif
Other DBs
NCBI-ProteinID: ANU14037
UniProt: A0A1C7DRM2
LinkDB All DBs
Position
complement(2750737..2751330)
Genome map
AA seq 197 aa AA seqDB search
MYVMKQTGWVELICGSMFSGKSEELIRRVRRSQFAKQKIAVFKPKIDDRYSKEAVVSHNG
ATVIALPISRSSEMWDYITDEFDVIAIDEAQFFDEAIIENVQKLANHGFRVIVAGLDQDF
RGRPFGPMPALLAIAEQVTKLQAVCTVCGSPASRTQRLIDGKPAGSDDPTILVGASEAYE
PRCRHHHEVPTGVTVSE
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtatgtcatgaaacaaacgggatgggttgaactgatttgcgggagcatgttttccggg
aaatcagaagaactgatccgtcgtgtccgccgttcccaatttgcaaaacaaaaaattgct
gtatttaaaccgaaaatcgacgaccgctacagtaaagaagcggttgtttcgcataatggt
gcaactgtgattgcactaccaatttctcgttcttctgaaatgtgggattacatcacagac
gaatttgatgtaattgctatagatgaagctcaattttttgatgaagccattatcgaaaat
gttcaaaaacttgcaaatcacggtttccgtgtaattgttgcgggcttagaccaagacttt
agaggccgtccgttcggaccaatgcctgcgttactagcaattgctgagcaagtaacgaaa
cttcaagcagtttgtacagtttgtggttctcccgcaagccgaactcaacgtttgatcgac
ggaaaaccagcaggctcagatgacccaacaattttagtgggtgcatcagaagcatacgaa
ccgcgctgccgccatcatcacgaagttccaacaggtgtaactgttagcgaataa

DBGET integrated database retrieval system