KEGG   Planococcus halocryophilus: BBI08_10825Help
Entry
BBI08_10825       CDS       T04473                                 

Definition
(GenBank) MFS transporter
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
phc  Planococcus halocryophilus
Brite
KEGG Orthology (KO) [BR:phc00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    BBI08_10825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1 DUF2781
Motif
Other DBs
NCBI-ProteinID: ANU14329
UniProt: A0A1C7DRX3
LinkDB All DBs
Position
3059720..3061216
Genome map
AA seq 498 aa AA seqDB search
MSEKYSRQEIVKSVPQKGFFGHPKGLFTLFFTEFWERFSYYGMRAILVFYMYYEMSEGGL
GLDQTTALSIMSIYGSLVYMSGIIGGWLADRIFGTSKAIFYGGILIMLGHIALAIPGNLA
LFFVSMVLIVLGTGLLKPNVSSVVGEIYEENDDRRDAGFSIFYMGINMGGFLAPLIVGTV
GMKISFHLGFSIAAVGMFLGLVIFVLTKKKNLGLAGTVVPNPLLPSERKATIRAFTIGAL
VIAAAIAIGIPTGLLTFNSFVGIVGVFGILIPVLYFTVMYRSKKTTEVERSHLLAYIPLF
IASVMFWAIQEQGSTILAAYADTRTDLEFAGITISPAWFQSLNPLFIIMLAPVFAWMWVK
LGSKQPSIPQKFSLGLLFAGLSFLVILLPAYFGGPSALVNPLWLVLSYFIVVLGELCLSP
VGLSATTKLAPAAFSAQTMSLWFLSNAAAQAINAQLVKFYTVENEMMYFGIIGGVSIVLS
IALFAFAPRIQSFMKGVR
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaaagtattctcgacaagagattgttaaaagcgttcctcaaaaaggctttttt
ggtcatccaaaagggttgttcacattattcttcactgagttctgggaacggttctcttat
tatgggatgagagccattctagttttctatatgtattacgaaatgtccgaaggtggactt
ggtcttgatcaaacgactgcattatccattatgtctatttatggatcactcgtttacatg
tctggaattatcggtggttggttagctgacaggatattcggtacttctaaagccatattt
tacggtgggatacttattatgcttgggcatattgctctagctatacccggaaatcttgct
ttattctttgtttcaatggtcttaattgtactgggtaccggtttattaaaaccaaacgta
tcgagtgtggtcggcgagatttatgaagaaaatgatgaccgacgcgatgcagggtttagt
attttctatatggggatcaacatgggtggtttcttagcgccattaattgttggtactgtc
ggaatgaaaatcagcttccacttaggttttagtattgccgctgtcgggatgttccttggt
ctagtaatatttgttcttacgaagaaaaaaaatcttggcttagcaggaactgttgtgcca
aacccgttattgccttcagaacgcaaggcaacgattcgagcgttcactatcggcgcatta
gtcattgcggcagcaattgctatcgggattccaacaggtctattgacgttcaatagtttc
gtcggaattgtcggggtttttggtattttaattcctgttttgtatttcactgttatgtat
cgcagcaaaaagacaacagaagtggaacgctcacatttgttggcttatattcctttattt
atcgcgtcagttatgttctgggcgattcaagaacaaggttcaacaattcttgctgcatac
gcagatactcgcacagatcttgaatttgcaggaatcaccatctcgcctgcttggttccaa
tcgttaaatccattattcatcataatgttagcgccagtctttgcttggatgtgggttaaa
cttggaagcaaacaaccatctattccgcaaaagttctctctcggattactatttgccggt
ttgtctttcttagttattttattaccagcttattttggtggaccatcagcattggttaat
ccactttggcttgttcttagttatttcatcgttgtattaggtgaactttgcctatctcca
gttgggttatcagcaacaactaaattggcacccgctgctttctcagctcaaacaatgagt
ttatggttcctttctaacgctgctgctcaagccatcaacgcgcagttggttaagttctac
acagttgaaaacgaaatgatgtatttcggaatcatcggtggtgtttcaatcgttctaagt
atcgcgttgtttgcctttgcaccacgcattcaaagcttcatgaaaggcgttcgctaa

DBGET integrated database retrieval system