KEGG   Planococcus halocryophilus: BBI08_12235Help
Entry
BBI08_12235       CDS       T04473                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
phc  Planococcus halocryophilus
Brite
KEGG Orthology (KO) [BR:phc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BBI08_12235
Enzymes [BR:phc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     BBI08_12235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_oxidored Thioredoxin_3 HI0933_like Thi4 DAO FAD_binding_3 AlaDh_PNT_C FAD_binding_2 NAD_binding_8 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ANU14595
UniProt: A0A1C7DSZ8
LinkDB All DBs
Position
3367137..3368684
Genome map
AA seq 515 aa AA seqDB search
MILDTAIKAQLEQYLQLLENDVLLKVSAGTDKVSRDMMALVEEVSAMSSRITVEYAELER
TPSFSVNRPGQDTGVVFAGIPLGHEFTSLVLALLQVSGRAPKVEQKVIDQIQSIQGSYHF
DSYISLSCQNCPEVVQGLNLMSILNPNITHTMIDGAVYKAEVESKDIMAVPTVFLNGESF
GSGRMTLEELLAKLGSAPDASEFANKEPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
FGGQVMDTLSIENFISVKKTDGPKFAASLEEHVKEYDIDVMNLQRAKKLEKKDFFELELE
NGAVLKGKTIILSTGARWRNIGVPGEGEFKNKGVAYCPHCDGPLFAGKDVAVIGGGNSGV
EAAIDLAGIVNHVTVLEYNSELKADSVLQDRLRSLPNATVITNARTQEITGKDKVNGISY
LDLQTGNVNHIELAGVFVQIGLVPNTDWLGDLVERTQHGEIVIDQRGATNVSGVFGAGDC
TNIPYKQIIISMGSGATASLSAFDHLIRSEVPVLV
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atgatattagatacagcaataaaagctcaattagaacagtatctacaattgcttgaaaac
gatgtgttgttaaaagtcagcgcaggcactgataaagtttctcgcgatatgatggcattg
gtcgaagaggtatctgcaatgtcttctcgtattactgtagagtatgcagagcttgaaaga
acgccaagctttagcgtcaaccgcccaggacaagacactggtgttgtatttgccggtatt
cctttagggcatgagtttacgtctctggttcttgcgttattgcaagtgagcggacgtgcg
ccaaaagttgagcaaaaagtaatcgatcaaattcaaagcatccaaggctcgtatcatttc
gactcctacattagcttgagctgccagaactgtcctgaagttgttcaagggctcaactta
atgagtattctcaacccaaacatcacacacacaatgattgatggcgcggtatacaaagca
gaagttgaaagcaaagacattatggccgtgcctactgttttcttaaatggggaatcgttc
ggtagcggacgtatgacacttgaagaactgttagctaaactcggcagcgctccagatgcc
tccgaatttgcgaacaaagaaccgtatgacgtgcttgttgtcggtggcggaccggctgga
gctagtgctgccatttacgcggcacgcaaaggtatacgtaccggcattgttgctgaacgc
tttggcggtcaagtcatggatacgttgagtatcgagaacttcattagtgtaaaaaagaca
gatggcccgaaatttgcggcaagtcttgaagaacatgtgaaggaatacgatatcgacgtt
atgaacttgcaacgcgcgaaaaagttggagaaaaaagattttttcgagcttgaacttgaa
aacggtgctgtcttaaaaggcaaaacgattattctttcaacaggtgcacgttggcgcaat
attggcgtgccaggtgaaggggagtttaagaataaaggtgtcgcttactgtccacattgt
gatggtccattgtttgcgggcaaagacgtagcggttatcggcggcgggaactccggcgtc
gaagcagcaattgatctcgcaggtatcgtaaatcacgtgactgttctggagtacaactca
gaactcaaagccgattctgttttacaagatcggctacgcagcctacccaatgcaacagtc
atcacaaacgctcgaactcaagaaattaccggcaaagataaagtaaacggcatttcttat
ctcgaccttcaaaccggaaacgtcaaccacatcgaattagctggcgtgtttgttcaaatc
ggccttgtgccgaatacagactggctaggcgatttggttgaacgcacacagcatggcgaa
atcgtcattgaccaacgtggcgctaccaacgtttcaggtgtatttggtgcgggagactgc
accaacattccttataaacaaatcatcatttcaatggggtctggtgcaactgcctcactg
agtgcttttgatcaccttattagaagtgaagttcctgttttggtttaa

DBGET integrated database retrieval system