KEGG   Pantholops hodgsonii (chiru): 102315752Help
Entry
102315752         CDS       T02909                                 

Gene name
HK1
Definition
(RefSeq) hexokinase 1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00010  Glycolysis / Gluconeogenesis
phd00051  Fructose and mannose metabolism
phd00052  Galactose metabolism
phd00500  Starch and sucrose metabolism
phd00520  Amino sugar and nucleotide sugar metabolism
phd00524  Neomycin, kanamycin and gentamicin biosynthesis
phd01100  Metabolic pathways
phd01200  Carbon metabolism
phd04066  HIF-1 signaling pathway
phd04910  Insulin signaling pathway
phd04930  Type II diabetes mellitus
phd04973  Carbohydrate digestion and absorption
phd05230  Central carbon metabolism in cancer
Module
phd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
phd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102315752 (HK1)
   00051 Fructose and mannose metabolism
    102315752 (HK1)
   00052 Galactose metabolism
    102315752 (HK1)
   00500 Starch and sucrose metabolism
    102315752 (HK1)
   00520 Amino sugar and nucleotide sugar metabolism
    102315752 (HK1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    102315752 (HK1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    102315752 (HK1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102315752 (HK1)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102315752 (HK1)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102315752 (HK1)
  09167 Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    102315752 (HK1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:phd04131]
    102315752 (HK1)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     102315752 (HK1)
Membrane trafficking [BR:phd04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    102315752 (HK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD UvrD-helicase
Motif
Other DBs
NCBI-GeneID: 102315752
NCBI-ProteinID: XP_005968576
LinkDB All DBs
Position
Un
AA seq 917 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYAMRLSDETLLDIMNRFKKEMKNGLSRDFNPTAT
VKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEQNQAVHMESEVYDTPENIMH
GSGSQLFDHVAECLGDFMEKKKIKDKKLPVGFTFSFPCRQSRIDEAILITWTKRFKASGV
EGTDVVKLLDKAIKKRGDYDANIVAVVNDTVGTMMTCGYDDQQCEVGLIIGTGTNACYME
ELRHIDLVEGDEGRMCINTEWGAFGDDGALEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAKEGLLFEGRITPELLTRGKFNTSDVSAIEKNKEGLHNAKEILTRLG
VEPSDDDCVSVQHVCTIVSFRSANLVAATLGAILSRLRDNKGTPRLRTTVGVDGSLYKTH
PQYSRRFHKTLRRLVPDCDVRFLLSESGSGKGAAMVTAVAYRLAEQHRQIEETLAHFSLT
KEMLLEVKKRMRAEMELGLGKQTHDKAVVKMLPSFVRSTPDGTENGDFLALDLGGTNFRV
LLVKIRSGKKRSVEMHNKIYAIPIEIMQGTGEELFDHIVSCISDFLDYMGIKGPKMPLGF
TFSFPCKQTSLDAGILITWTKGFKATDCVGHDVATLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPSCEVGLIVGTGSNACYMEEMKNVETLEGNQGQMCINMEWGAFGDNGCLDD
IRTIYDKLVDEFSLNSGKQRYEKMISGMYLGEIVRNILIDFAKRGFLFRGQISEPLKTRG
LFQTKYLSQIESDRLALLQVRAILQQLGLNSTCDDSILVKTVCGVVSKRAAQLCGAGMAA
VVDKIRENRGLDRLNVTVGVDGTLYKLHPHFSRIMHQTVKELSPKCNVSFLLSEDGSGKG
AALITAVGVRLRQEMSS
NT seq 2754 nt NT seq  +upstreamnt  +downstreamnt
atgatcgccgcgcagctcctggcttattacttcaccgaactgaaggatgaccaggtcaaa
aagattgacaagtatctctatgccatgcggctctctgatgaaactctgttagatatcatg
aatcgtttcaaaaaggagatgaagaatggcctctcccgggattttaatccgacagccaca
gtcaagatgttgccaacgtttgtaaggtctattcccgatggctcagaaaagggagatttc
atcgccctggatcttggtggatcttcctttcgaattctgcgggtgcaggtgaatcatgag
cagaaccaggctgttcatatggagtctgaggtttatgacaccccggagaacatcatgcat
ggcagtggaagccagctttttgatcacgtcgctgagtgcctgggagacttcatggagaaa
aaaaaaatcaaggacaagaaattacctgtgggattcacgttttctttcccttgtcggcaa
tccagaatagacgaggccatcctgatcacctggacaaagagatttaaagcgagcggcgtg
gagggaactgatgtggtgaagctgcttgacaaagccatcaaaaagcgtggggactatgat
gccaacattgtggctgtggtgaacgacacggtggggaccatgatgacctgtggctacgac
gaccagcagtgtgaagtcggcctcatcattggtactggcaccaacgcgtgctacatggag
gaactgaggcacatcgacctggtggagggcgacgaggggcggatgtgcatcaacaccgag
tggggggccttcggggacgacggggccctggaggacatccgcactgagttcgaccgggag
atagaccgggggtcgctcaaccccgggaagcagctgttcgagaagatggtcagtggcatg
tacctgggcgagctggtccgactgatcctggtcaagatggccaaggagggcctcttattt
gaagggcggatcacccctgagctgctcaccagagggaagttcaacaccagtgacgtgtcg
gccatcgaaaagaataaggaaggcctccacaatgccaaagaaatcctgacccgcctggga
gtggagccgtctgatgacgactgtgtttcagttcagcacgtgtgcaccatcgtctcattt
cgctctgccaacctggtggcggcgaccctgggcgccatcttgagccgcctccgagataac
aagggcacgcccaggctgcggaccacggttggtgtcgacgggtccctttacaagacgcac
ccacagtattctcggcgtttccacaagactctgcggcgcttggtacccgactgcgatgtg
cgtttcctcctctccgagagtggcagtggcaagggggccgccatggtgactgccgtggcc
taccgcctggctgagcagcaccggcagatagaggaaaccctggcccacttcagtcttacc
aaggaaatgctgctggaggtgaaaaagaggatgcgggctgagatggaattggggctgggc
aagcagacgcatgacaaggctgtggtcaagatgctgccctccttcgtccggagcactcct
gatgggactgagaatggtgacttcttggccctggatcttggaggaacgaatttccgcgtc
ctgctggtgaaaatccgtagtgggaaaaagagatcggtggaaatgcacaataagatctac
gccattcccattgaaatcatgcagggcactggggaggagctgtttgaccacatcgtttcc
tgcatctctgacttcctggactacatgggcatcaagggccctaaaatgcctctgggcttc
acattttcgtttccttgcaagcagacgagcttagatgcgggtatcctaatcacctggacc
aaaggctttaaggcaaccgactgcgtggggcacgatgtagcaaccttactgagggaggcg
ataaagaggagagaggaatttgacctggacgtggtggctgtggtcaatgacacggtgggc
accatgatgacctgtgcttatgaggagcccagctgcgaggttggactcatcgtagggact
ggcagcaatgcctgctacatggaggaaatgaaaaacgtcgagacgctagaaggaaaccag
ggacaaatgtgtatcaacatggagtggggggcttttggggacaacgggtgtctggatgat
atcagaacaatctatgacaaactggtggatgagttttctctaaactctgggaagcaaagg
tatgagaagatgatcagcggtatgtacctgggtgagattgtccgcaacatcttgatcgac
ttcgccaagaggggcttcctcttccgggggcagatctctgagccgctgaagacccggggc
ctctttcagaccaagtatctctctcagatcgagagcgaccgattagcgctactgcaggtc
cgggccatcctccagcagctgggtctgaacagcacatgcgacgacagtatcctcgtgaag
accgtgtgtggggtggtgtccaagagggcggcgcagctgtgtggcgcaggcatggctgct
gtggtggataagatccgcgaaaacagggggctggaccgcctcaacgtgaccgtgggcgtg
gacggcacgctctacaagcttcatccacacttctccagaatcatgcaccaaaccgtgaag
gaactgtcaccaaagtgtaacgtgtccttcctcttatctgaagacggcagcggcaaggga
gccgccctcatcacagcagtgggtgttcggctccggcaggaaatgagcagctaa

DBGET integrated database retrieval system