KEGG   Pantholops hodgsonii (chiru): 102316293Help
Entry
102316293         CDS       T02909                                 

Gene name
PFKM
Definition
(RefSeq) phosphofructokinase, muscle
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00010  Glycolysis / Gluconeogenesis
phd00030  Pentose phosphate pathway
phd00051  Fructose and mannose metabolism
phd00052  Galactose metabolism
phd01100  Metabolic pathways
phd01200  Carbon metabolism
phd01230  Biosynthesis of amino acids
phd03018  RNA degradation
phd04152  AMPK signaling pathway
phd05230  Central carbon metabolism in cancer
Module
phd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102316293 (PFKM)
   00030 Pentose phosphate pathway
    102316293 (PFKM)
   00051 Fructose and mannose metabolism
    102316293 (PFKM)
   00052 Galactose metabolism
    102316293 (PFKM)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102316293 (PFKM)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102316293 (PFKM)
 09160 Human Diseases
  09161 Cancers: Overview
   05230 Central carbon metabolism in cancer
    102316293 (PFKM)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102316293 (PFKM)
Protein phosphatases and associated proteins [BR:phd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102316293 (PFKM)
Messenger RNA biogenesis [BR:phd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102316293 (PFKM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK Phage_TAC_14
Motif
Other DBs
NCBI-GeneID: 102316293
NCBI-ProteinID: XP_005981072
LinkDB All DBs
Position
Un
AA seq 851 aa AA seqDB search
MRKVELHLKFFMCVTQSRQLVRTPQRTAEEASTSSMLIQKPPSGTDALKSLDTVDDPDTV
EGIPIIENEWIMTHEEHHEAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVF
FVHEGYQGLVDGGDNIREATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAHNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKSGKITAEEATKSSYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDKHGKPITSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTRAMDERRFDEAMKLRGRSFMNNWEVYKLLAHIRPPKSKSGSHTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEVGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKLYDELCIPFVVIPATV
SNNVPGSDFSVGADTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALVFQPVTELQEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHLEH
ITRKRSGEANM
NT seq 2556 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaagtggaattgcatctgaaatttttcatgtgtgtaactcagtctcgccagtta
gtcaggactcctcagagaacagctgaagaagcttcaacttccagcatgctcatacaaaag
ccaccgtctgggacagatgccttgaagagtctagataccgtggatgatccagacactgtg
gaaggcatacccattattgaaaatgagtggatcatgacccatgaagagcaccatgaagcc
aaaaccctgggaatcggcaaagccatcgccgtgttaacctctggtggcgatgcccaaggt
atgaatgctgctgtcagggctgtggttcgtgttggcatctatactggtgcccgtgtcttc
tttgtccatgagggttatcaaggcctggtagatggtggagataacatccgggaagccaca
tgggagagcgtctcgatgatgcttcagctgggaggcacagtgattggaagcgcccggtgc
aaggactttcgggaacgggaaggccggctccgagctgcccacaacctggtgaagcgtggg
atcaccaacctgtgtgtcattgggggagacggcagcctcactggggccgacaccttccgc
tctgagtggagtgacttgttgagtgacctccagaaatcaggcaagatcacagcagaggag
gctaccaagtccagctacctgaacatcgtgggcctggttggctcaattgacaatgacttc
tgtggcactgatatgaccattggcaccgattctgccctgcaccggatcatagagattgta
gatgccatcactactactgctcagagccaccagaggacctttgtgttggaggtgatgggc
cggcactgtggatacctggcccttgtcacttccctctcctgtggggccgactgggtcttc
attcccgagtgtccaccagatgacgactgggaggaacacctttgtcgtcggctcagcgag
acaaggaatcgtggttctcgtctcaacatcatcatcgtagctgagggtgcgattgacaag
catgggaaaccaatcacctctgaagacataaaaaatctggtggttaaacgtcttggatat
gatacccgggtcactgtcttggggcatgtgcagcggggtgggacaccgtcagcctttgac
agaatcctgggcagcaggatgggtgtggaagcagtaatggcgcttttggaggggaccccg
gacaccccagcctgtgtggtgagcctctctggtaaccaggctgtgcgcctgcccctcatg
gagtgtgtgcaggtgaccaaggacgtgaccagggccatggatgagaggagattcgatgaa
gccatgaagttgaggggccggagcttcatgaacaactgggaggtatacaagcttctggct
cacatcagacccccaaagtctaagagtggctcgcacacggtggccgtgatgaacgtgggc
gcgccggctgcgggcatgaacgccgccgttcgttccactgtgagaatcggcctcatccag
ggcaaccgagtgctggtggtgcacgatggcttcgagggcctggccaagggccagatcgag
gaagttggatggagctacgttgggggctggactggccaaggtggttctaaacttgggact
aaaaggactctacccaagaagagctttgaacagatcagtgccaacatcacgaagtttaat
attcagggccttgtcatcatcgggggctttgaggcgtacacggggggcctggagctgatg
gagggcaggaagctgtatgatgagctctgcatccccttcgtggtcatccctgccacggtc
tccaacaatgtgcccggctcggacttcagcgtgggggctgacactgccctcaataccatc
tgcatgacgtgtgaccgcatcaagcagtcagcggcaggcaccaagcgccgtgtgtttatc
attgaaacaatgggcggctactgtggctacctggccaccatggcaggcctggcagccggg
gctgatgctgcgtatatttttgaggagcccttcaccattcgagacctgcaggtgaatgtg
gagcatctggtgcaaaagatgaaaacaactgtgaagaggggcctggtgttaaggaacgag
aagtgcaatgagaactacaccactgacttcatcttcaacttgtactctgaggaggggaag
ggcatcttcgacagcaggaagaacgtgctgggccacatgcagcagggtgggagcccaact
ccattcgataggaattttgccactaagatgggtgcaaaggctatgaactggatgtcaggg
aaaatcaaagagagttaccgtaacgggcggatctttgctaataccccagactcaggctgt
gttctggggatgcgtaagagggccctggtcttccaaccagtgactgagttgcaggaacag
acggattttgagcaccgcatccccaaggagcagtggtggctgaagctgaggcccatcctc
aagatcctcgccaagtacgagattgacttggatacctcagagcacgcccacctggagcac
atcactcggaagcggtctggagaagctaacatgtag

DBGET integrated database retrieval system