KEGG   Pantholops hodgsonii (chiru): 102318599Help
Entry
102318599         CDS       T02909                                 

Gene name
RIBC2
Definition
(RefSeq) RIB43A domain with coiled-coils 2
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: RIB43A
Motif
Other DBs
NCBI-GeneID: 102318599
NCBI-ProteinID: XP_005958515
LinkDB All DBs
Position
Un
AA seq 377 aa AA seqDB search
MEVAQPKDLQEDFVLAKRRYAELGRQKRIFNARNRIIGGDTTAWDAQVCDQNIKAATEKA
REEAFAAEMRQNDKIACISENRERRDRKNLCKAINDFQQSFQRPETRREFDLSDPLALKK
DRPARQSDYDAWNSISGMQKFMGEDLNFHLRKKFQEEQNREWSLQQQREWMVGRENQKCA
EDLCLKTRLQFDETAKHLQNLETATRKAVCTTVKEFNMNQALESAEKKIQERKQEQEDNL
AEISNLLRGDLLSENPQQAASSFGPHRVVPDRWKGMSQEQLEEIRLVQKQQVQEKLRLQE
EERQRDMDWDRRRIQKARATLLFERQQQRLQRGLRRALDCSNLSLAREQLLQKEHMKELS
TNYAAEDYFTQFNTGSR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggaggtagcacagcccaaggacctgcaggaggattttgtcctggccaaaagaagatat
gcggagctgggcaggcagaaacggattttcaacgccaggaacaggatcattgggggtgac
accacggcctgggatgctcaggtttgtgaccagaacataaaagcagcaactgaaaaagcg
agagaggaagcctttgctgctgaaatgagacaaaatgacaagatcgcatgcatatcagaa
aaccgggaaaggagagataggaaaaatctctgtaaagctatcaacgatttccaacagagc
tttcagaggccggaaacgcgccgtgaatttgacctctctgaccccctagcccttaagaaa
gatcgtccagcccggcagtcagattatgatgcttggaattcaatatcaggaatgcagaaa
ttcatgggagaggatttaaacttccatctgaggaagaaattccaagaggaacaaaacagg
gaatggtccctgcaacagcaaagagaatggatggttggccgggagaaccaaaaatgtgca
gaggatctctgcttgaagacaaggctacagtttgatgagacagccaagcacttacagaat
ctggaaaccgccaccaggaaggcagtttgtacaactgtgaaagaattcaacatgaaccag
gccctggagtcagcggaaaagaaaatccaagagagaaaacaagaacaggaggacaaccta
gccgagatctccaacctgctgcgtggggacctgctgtcagagaacccacagcaggcagcc
agctccttcgggccgcatcgtgtggtgcctgaccgctggaagggcatgagccaggagcag
ctggaggagatccgcctggtgcagaaacagcaagtccaggagaagctgaggctccaggag
gaagagcgccagcgagacatggactgggaccggcggaggattcagaaggctcgtgccacc
ttgctgtttgagcggcagcagcagcgcctacagcgtggcctgcgcagggctctggactgc
agcaacctcagcctggccagggagcagctcctgcagaaagaacatatgaaagaactctct
accaattatgccgctgaagactatttcacgcaatttaatacaggaagtcgataa

DBGET integrated database retrieval system