KEGG   Pantholops hodgsonii (chiru): 102318954Help
Entry
102318954         CDS       T02909                                 

Gene name
GAA
Definition
(RefSeq) glucosidase alpha, acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00052  Galactose metabolism
phd00500  Starch and sucrose metabolism
phd01100  Metabolic pathways
phd04142  Lysosome
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102318954 (GAA)
   00500 Starch and sucrose metabolism
    102318954 (GAA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    102318954 (GAA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:phd04147]
    102318954 (GAA)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     102318954 (GAA)
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102318954 (GAA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 102318954
NCBI-ProteinID: XP_005958676
LinkDB All DBs
Position
Un
AA seq 937 aa AA seqDB search
MMRWPPCSRTLLGFCTLLSLALLGHILLHDLEVVPRELRGFSQDEIHQACQPGASSPECR
GSPRAVPTQCDLPPNSRFDCAPDKGITQQQCEARGCCYVPAEWPPDAQMGQPWCFFPSSY
PSYRLENLTSTETGYTATLTRAIPTFFPKDIMTLRLDVLMETESRLHFTIKDPANRRYEV
PLETPRVCSQAPFTLYSVEFSGEPFGVVVRRKLDGRVLLNTTVAPLFFADQFLQLSTSLP
SHYITGLAEHLGSLMLSTNWTKITLWNRDIAPEPNVNLYGSHPFYLVLEDGGLAHGVFLL
NSNAMDVVLQPSPALSWRSTGGILDVYVFLGPEPKSVVQQYLDVVGYPFMPPYWGLGFHL
CRWGYSTSAITRQVVENMTRAYFPLDVQWNDLDYMDARRDFTFNKDHFGDLPAMVQELHQ
GGRRYIMIVDPAISSSGPAGTYRPYDEGLRRGVFITNETGQPLIGQVWPGLTAFPDFTNP
EALDWWQDMVTEFHAQVPFDGMWIDMNEPSNFVRGSVDGCPDNSLENPPYLPGVVGGTLR
AATICASSHQFLSTHYDLHNLYGLTEALASHRALVKARGMRPFVISRSTFAGHGRYSGHW
TGDVWSNWEQLSYSVPETLLFNLLGVPLVGADICGFLGNTSEELCVRWTQLGAFYPFMRN
HNALISQPQEPYRFSETAQQAMRKAFTLRYVLLPYLYTLFHGAHVRGETVARPLFLEFPE
DPSTWTVDRQLLWGEALLITPVLEAEKVEVTGYFPQGTWYDLQTVPMEAFGSLLPPAPLT
SVIHSKGQWVTLSAPLDTINVHLRAGHIIPMQGPALTTTESRKQPMALAVALTASGEAQG
ELFWDDGESLGVLDGGDYTQLIFLAKNNTFVNKLVHVSSEGAGLQLSNVTVLGVATAPQQ
VLCNSVPVSNFTFNPDTETLAIPVSLTMGEQFVISWS
NT seq 2814 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtggccaccctgctcccgcaccctgctggggttctgcaccctcctctccttg
gccctcctggggcacatcctgcttcatgacttggaggtggtcccccgagaactacgaggc
ttctcccaagatgagattcaccaagcttgccagccaggagccagcagcccagaatgccgt
ggcagccccagggcagtgcccacacagtgcgatctgccccccaacagccgcttcgactgc
gccccagacaagggcatcacccagcagcagtgtgaggcccgcggctgctgctacgtgcct
gcagagtggcctccggatgcccagatggggcagccctggtgcttcttcccttccagctac
cccagttacaggctggagaacctgacctccactgagacagggtacacggccaccctgacc
cgtgccatcccgaccttcttccccaaggacatcatgaccttgaggctggacgtgttgatg
gagaccgagagcagacttcacttcacgattaaagatcccgccaacagacgctatgaggtg
cccttggagaccccgcgtgtctgcagccaggcaccgttcacactctacagcgtggagttc
tcgggggagccctttggtgtggtcgtgcggcggaagctggacggacgggtgctgctgaac
actacggtggcccccctgttctttgcggaccaatttctgcagctgtccacctccctgcca
tcccactacatcacaggccttgccgaacaccttgggtccctgatgctcagcaccaactgg
accaagatcaccctctggaaccgggacatcgcccctgagcccaacgtgaacctgtacgga
tctcatcctttctacctggtcctggaggatggcgggttggctcacggggtcttcctgctg
aacagcaatgccatggatgtggtcctgcagcccagcccagccctcagctggaggtcgaca
ggcgggatcctggacgtgtacgtcttcctgggcccggagcccaagagcgtggtgcagcag
tacctggacgtcgtgggctacccgttcatgccgccgtactggggcctgggcttccacctg
tgccgctggggctactccacctctgccatcacccgccaggtcgtggagaacatgaccagg
gcctacttccccctggacgtccaatggaatgacctcgactacatggatgccagacgggac
ttcactttcaacaaggaccacttcggggacttgccggccatggtgcaggagctccaccag
ggtggtcggcggtacatcatgatcgtggatcctgccattagcagctcaggccctgctggg
acctaccgaccctacgacgagggtctgaggcggggggtcttcatcaccaatgagactggg
cagccactgattgggcaggtgtggcccggactcaccgccttccccgacttcaccaacccc
gaagctcttgactggtggcaggacatggtgaccgagttccacgcccaagtgcccttcgat
ggcatgtggattgatatgaacgagccatccaattttgtgaggggctcagtggatggctgc
ccagacaacagcctggagaacccgccctacctgccgggggtggttggcgggaccctccgg
gcagccaccatctgcgcctccagccaccagttcctgtccacgcactacgacctgcacaac
ctgtatggcctgactgaagccttagcctcccacagggccctggtgaaggctcgagggatg
cgacccttcgtgatctctcgctcaacctttgccggccacggccgatactctggccactgg
acaggggatgtgtggagcaactgggagcagctttcctactctgtgccagaaaccctgctt
ttcaatctgctgggggtgcccctggtgggggccgacatctgtggcttcctgggcaacacc
tcagaggagctgtgtgtgcgttggacccagctgggggccttctaccccttcatgcggaac
cacaatgccctgatcagccagccgcaggaaccatacaggttcagcgagacggcgcagcaa
gccatgaggaaggccttcaccctgcgctacgtgctgctgccctatctctacactctgttc
cacggggcccacgtcagaggcgagacggtggcccggcccctcttcctggagttccccgag
gaccccagcacctggactgtggaccgccagctcctgtggggggaggctctgctcatcacc
ccagtgctcgaggctgagaaggttgaagtcactggctacttcccccagggcacatggtac
gacctgcagacggtaccaatggaagcctttggcagcctcctgcctcctgcacccctcacg
tctgtcatccacagcaaggggcagtgggtgacgctgtctgccccgctggacaccatcaac
gtccacctccgggccgggcacatcatccctatgcagggccctgccctcacgaccaccgag
tcccgcaagcagcccatggccctggctgtggccctgacagccagtggggaggcccaaggg
gagctgttctgggatgacggggagagcctgggagtgctggatggtggggactacacgcag
ctcatcttcctggccaagaacaacacctttgtaaacaagctggtgcacgtgagcagtgag
ggggccggcctgcagctgagcaacgtgaccgtcctgggggtggccacagccccgcagcag
gtcctctgcaacagcgttcctgtctccaacttcaccttcaaccctgacacggagactctg
gccatccctgtctcgctgaccatgggagagcagtttgtcatcagttggtcttaa

DBGET integrated database retrieval system