KEGG   Pantholops hodgsonii (chiru): 102319508Help
Entry
102319508         CDS       T02909                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00590  Arachidonic acid metabolism
phd01100  Metabolic pathways
phd04611  Platelet activation
phd04726  Serotonergic synapse
phd04923  Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102319508 (PTGS1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    102319508 (PTGS1)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102319508 (PTGS1)
  09156 Nervous system
   04726 Serotonergic synapse
    102319508 (PTGS1)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102319508 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 102319508
NCBI-ProteinID: XP_005974015
LinkDB All DBs
Position
Un
AA seq 600 aa AA seqDB search
MSRQSLSLRFPLFLLLLSPSPVFSADPGAPTPVNPCCYYPCQHQGICVRFGIDRYQCDCT
RTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVR
SNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMGTKGKKQLPDAELLSRR
FLLRRKFIPDPQGTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLER
QYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLML
YATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLK
FDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVE
ALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRELRLQPFNEYRKRFGMKPYTSFQE
LTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPIC
SPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgagccggcagagcctctcgctccgattcccgctgtttctcctgctgctgtcgccatcc
cccgtcttctcagcggaccccggggcgcccacgccagtgaacccctgctgttactatcca
tgccagcaccagggaatctgtgttcgcttcggcattgaccgctaccaatgtgactgcacc
cgcacgggctattccggccccaactgcaccatccctgagatatggacctggctccggacg
actttgcggcccagcccctctttcatccactttctgctgacgcacgggcgctggctttgg
gattttgtcaatgccaccttcatccgggacacgctcatgcgtctggtactcacagtgcgt
tccaaccttatccccagccctcccacctacaacatagcgcacgactacatcagctgggag
tccttctccaatgtgagttattatactcgcattctgccctccgtgccccgagactgtccc
acgcccatgggcaccaaagggaagaagcaattgccagatgcggagctcctgagccgtcgc
ttcctgctcaggaggaagttcatccccgaccctcaaggcaccaacctcatgtttgccttc
tttgcccaacacttcacccatcagttcttcaaaacttccggcaagatgggtcctggcttc
accaaggcgctgggccacggggtagaccttggccacatttatggagacaatctggaacgt
cagtatcagctgcggctctttaaggatgggaagctcaagtaccagatgctcaatggagag
gtgtacccgccatcggtggaagaggcgcccgtgctgatgcactaccctcggggcatcccg
ccccagagccagatggctgtgggccaggaggtgtttgggctgcttcctgggctcatgctc
tacgccacgatctggctgcgtgagcacaaccgcgtgtgtgacctgctgaaggctgagcac
cccacctggggcgacgaacagctcttccagacggcccgcctcatcctcatcggggagacc
atcaagattgtgatagaggagtacgtgcagcagctgagcggctacttcctgcagctcaag
ttcgacccagagctgctgttcggggcccagttccagtaccgcaaccgcatcgccatggag
ttcaaccagctgtaccactggcacccgctcatgccggactccttccgggtgggcccccag
gactacagctacgagcagtttctgttcaacacctccatgctggtggactacggggtcgag
gccctggtggacgccttttctcgccagcctgcaggccggattggtgggggtaggaacata
gaccaccacatcctgcacgtggccgtggatgtcatcaaggaatcacgggagctgaggctg
cagcccttcaatgagtaccgcaagaggtttggcatgaagccctacacctctttccaagag
ctcacaggtgagaaggagatggcagctgagttggaggagctgtatggagacatcgatgct
ttggaattctacccggggctacttcttgagaagtgccatccaaactccatctttggggag
agtatgatagaaatgggggctcctttttcccttaagggcctcttaggaaaccccatctgt
tctccagagtactggaaggcaagcacatttggtggtgaggtgggcttcaaccttgtcaag
acggccacgctaaagaagctggtttgcctcaacaccaagacttgtccctatgtctccttc
cacgtgccagacccccgtcaggaggacaggcctggggtggagcggccacccacagagctc
tga

DBGET integrated database retrieval system