KEGG   Pantholops hodgsonii (chiru): 102319680Help
Entry
102319680         CDS       T02909                                 

Gene name
HDAC7
Definition
(RefSeq) histone deacetylase 7
  KO
K11408  histone deacetylase 7 [EC:3.5.1.98]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd05034  Alcoholism
phd05165  Human papillomavirus infection
phd05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:phd00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102319680 (HDAC7)
  09164 Substance dependence
   05034 Alcoholism
    102319680 (HDAC7)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    102319680 (HDAC7)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phd03036]
    102319680 (HDAC7)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102319680 (HDAC7)
Chromosome and associated proteins [BR:phd03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102319680 (HDAC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl
Motif
Other DBs
NCBI-GeneID: 102319680
NCBI-ProteinID: XP_005981084
LinkDB All DBs
Position
Un
AA seq 988 aa AA seqDB search
MDLRVGQRPTVDAPPEPTLLALQHPQRLHHHLFLAGLQPQRSAEPMRLSMDTPMPELQMG
QQEQELRQLLNKDKSKRSAVASSVVKQKLAEVILKKQQAALERTVHPNSPSVPYRTLEPL
ETEGAARSMLGSFLPPVPSLPCDPPEHFPLRKTVSEPNLKLRYKPKKSLERRKNPLLRKE
SAPPSLRRRPAETLGDSSPSSSSTPASGCSSPNDSEHGPNPVLGSEAHLGQRLRLQETSL
APLALLPTITLGLPAPARADGDRRTHATLGPRGPVLGNPHAHLFLPHGLEPEAGGPLPSR
LQPILLLDPSVSHTPLLTVPGLGPLPFHFAQSLLTTERPSGSGLHRPLSRTRSEPLPPSA
TAPSLLGPLQPRLERLKPHVQLIKRSAKPSEKPRLRQIPSAEDLETDSGSVGPLRDDGLE
HRESSHGQQEARGPVPLQQHQQVFLWEQQRLAGRLPRGATGDSMLLPLAPGSHRPLSRAQ
SSPAAPASLPTPEPASQARILPSSETPARTLPFTTGLVYDSVMLKHQCSCGDNSRHPEHA
GRIQSIWSRLLERGLRSQCESLRGRKASLEELQSVHSERHVLLYGTNPLSRLKLDNGKLA
GLLAQRMFVMLPCGGVGVDTDTIWNELHSSNAARWAAGSVTDLAFKVASRELKNGFAVVR
PPGHHADHSTAMGFCFFNSVAIACRQLQQQGKASKILIVDWDVHHGNGTQQTFYQDPNVL
YISLHRHDNGNFFPGSGAVDEVGAGSGEGFNVNVAWAGGLDPPMGDPEYLAAFRIVVMPI
AREFSPDLVLVSAGFDAAEGHPPPLGGYHVSAKCFGYMTQQLMSLAGGAVVLALEGGHDL
TAICDASEACVAALLGNKVDPLSEEGWKQKPNLNAIRSLEAVIRVHSEYWGCMQRLASHP
DSWVHRVPGADAEEVEAVTALASLSVGILAEAIRAWADGPSPAGIPPGPGIATPGFSGSW
APVLPVAPGTSLVPLPGPQGSWWRRRNP
NT seq 2967 nt NT seq  +upstreamnt  +downstreamnt
atggacctgagggtgggccagcggcccacggtggatgccccgccggagcccacactgctg
gccctgcagcacccccagcgcctccaccaccacctcttcctggcgggcctgcagccccag
cgctcggcagagcccatgcggctctcaatggacacgccgatgcccgagttgcagatgggg
cagcaggagcaagagctgcggcagcttctcaataaggacaagagcaagcgaagtgccgta
gccagcagtgtggtcaagcagaagctggcagaggtgattctgaagaaacaacaggcggcc
ctagagagaacggttcatcctaatagccccagcgttccctacagaactctcgagcccttg
gagacggagggagctgcccgttccatgctcggcagcttcctgcctcctgttcccagcctg
ccttgcgaccccccagaacacttccctctgcgcaagacagtctccgagcccaacctgaag
ctgcgctacaagcccaagaagtccctggagcggaggaagaacccgctactgcggaaggag
agcgcccctcccagcctccgtcggcggccagcagagacccttggcgactcctcccctagt
agtagcagcacgccggcatcagggtgcagctcccccaacgacagcgagcatggccccaac
cccgtcctgggctccgaggcgcacttgggccagcggctgcggctgcaggagacctctctg
gccccgctcgccttgctgcccacaatcacactggggctgcccgcccctgccagggctgat
ggtgaccgcaggacccatgcgactctgggccctcggggcccagtcctggggaacccccat
gctcacctcttcctgccccatggcctggagcccgaggctgggggccccctgccctctcgc
ctgcagcccattctcctcctggatccctcagtgtctcacacccctctgctgactgtgccc
gggcttgggccactgcccttccactttgcccagtccttactgaccaccgagcggccctct
ggatcaggcctccaccggccactgagccggacccgctcagagcccctgcccccaagcgcc
actgccccctcactgctgggccccctgcagccccgcctggagcggctcaaacctcacgtc
cagctgatcaagaggtcagccaagccgagtgagaagccccgactgcggcagataccctca
gctgaggacctcgagacggacagtgggagcgtggggccactgcgggatgatggcctggaa
catagggagtccagtcatgggcagcaggaggccagaggccctgttcctctccagcagcac
cagcaggtgttcctctgggagcagcagcggctggctgggcggctcccccgaggagccact
ggagactccatgctgcttcccctggccccgggcagtcaccggcccctgtccagggctcag
tcgtccccggccgcacctgcctcactgccgaccccagagcccgccagccaggcccgtatc
ctgcccagctcagagacccctgcccggaccctgcccttcaccactgggctggtctatgac
tcggtgatgctgaagcaccagtgctcctgcggggacaacagcaggcacccagagcatgcg
ggccgtatccagagcatctggtcccggctgctggaacgggggctccggagccagtgtgag
tctctccggggccggaaggcctccctggaggagctgcagtcggtgcactctgagcggcac
gtactcctctacggcaccaacccgctcagccgcctcaaactggacaatgggaagctggca
ggcctcctggcacaacggatgttcgtgatgctgccttgtggcggcgttggggtggacacc
gacaccatctggaatgagctgcactcctccaatgcggcccgctgggctgctggcagtgtc
accgacctcgccttcaaagtggcctcccgtgagctaaagaatggttttgctgtggttcgg
cccccaggacaccatgcagaccattccacagccatgggcttctgcttcttcaactcagtg
gccatcgcctgccggcagctgcaacagcagggcaaggccagcaagattctcattgtggac
tgggacgttcaccatggcaacggcacccagcagaccttctaccaggaccccaatgtgctg
tacatctcccttcatcgccatgacaacggcaacttcttccctggcagtggggctgtggat
gaggtgggagctggcagtggtgagggcttcaatgtcaacgtggcctgggctggaggtctt
gacccccccatgggggatcctgagtacctggctgccttcaggatagttgtgatgcccatc
gcccgggagttctctccggacctggtcctggtgtcggctgggtttgatgctgccgagggt
cacccgcccccactgggtggctaccatgtttctgccaagtgctttgggtacatgacacag
cagctcatgagcttggctggaggtgcggtggtgctggccctggaggggggccatgacctc
acagccatctgtgatgcctccgaggcctgcgtggctgctcttctgggcaacaaggtggat
cccctctcagaagaaggctggaagcagaaacccaacctcaatgccatccgctccctggaa
gctgtgatccgagtgcacagtgaatactggggctgcatgcagcgcctggcctcccatcca
gactcctgggtgcacagggtgccaggggctgacgcagaagaagtggaggcagtgacggcg
ttggcatccctctccgtgggcatcctggctgaagcgataagagcctgggctgacggcccc
tcccctgcagggatccccccaggtcccggcatagccactccaggcttctcaggaagctgg
gccccagtgctccctgtagccccaggcaccagccttgtccctctcccaggacctcagggc
agctggtggaggaggaggaacccatga

DBGET integrated database retrieval system