KEGG   Pantholops hodgsonii (chiru): 102320366Help
Entry
102320366         CDS       T02909                                 

Gene name
MGAM
Definition
(RefSeq) maltase-glucoamylase (alpha-glucosidase)
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00052  Galactose metabolism
phd00500  Starch and sucrose metabolism
phd01100  Metabolic pathways
phd04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    102320366 (MGAM)
   00500 Starch and sucrose metabolism
    102320366 (MGAM)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102320366 (MGAM)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     102320366 (MGAM)
    3.2.1.20  alpha-glucosidase
     102320366 (MGAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 102320366
NCBI-ProteinID: XP_005981933
LinkDB All DBs
Position
Un
AA seq 1832 aa AA seqDB search
MARKKLKKFTTLELMLSILLLVVFIITIPIFVLSARDSLESQDPGTTVSPDPGTSTTPGS
ADCPVVNDSERINCIPDQSPTKATCDQRGCCWSPQGTISKPWCYYSKNHGYQVGGDLVNT
NAGFTAQLERLSSPSLFGNDVNNVLLTAEYQTSNRFHFKLTDQNQNRYEVPHEHVQPFTG
NAASSLTYKVEVSKQPFGIKVIRTSNNRVLFDSSVGPLLFAHQFLQLSIRLPSANVYGLG
EHVHQQYRHDMNWKTWPIFARDTTPNGDGTNLYGAQTFFLCLEDASGLSFGVFLLNSNAM
EVFLQPTPAITYRTIGGILDFYVFLGNTPEQVVQEYLELIGRPALPSYWALGFHLSRYDY
GTLENMKEVVERNRAAQLPYDVQHADIDYMEARKDFTYDPVAFKGFPEFVKELHSNGQKL
VIIVDPAISNNSSLSNPYGPYDRGSDMKIWVNTSDGVTPLIGEVWPGKTVFPDYTNPKCT
AWWTNEFELFHSQVEFDGIWIDMNEVANFVDGSVSGCSTSNLNYPPFTPKILDGYLFSKS
ICMDAVQHWGQQYDVHNLYGYSMAIATVETVKTVFPNKRSLILTRSTFAGSGKFAAHWLG
DNAATWNDLRWSIPGMLEFNLFGIPMVGADICGFILDTSEELCRRWMQLGAFYPFSRNHN
GQGYKAQDPASFGTNSLLLNSSRHYLTVRYTLLPYLYTLFYRAHSRGDTVARPLLHEFYQ
DSNTWDVHQQFLWGPGLLITPVLDEGAEKVTAYMPDAVWYDYETGVQERWRKQKVEMELP
GDKIGLHLRGGYIFPTQQPATTTVASRQNPLGLIIALDENKEAKGELFWDDGETKDTVAN
NLYLLCEFSVTQNRLEVKILQSTYTDPNNLAFKEIKILGTQELNNVAVKQNGVPIQVSPN
VTYDSNLQVALITGIDLVLGGTYTVEWDVKIRDEEKIDCYPDETGVSAENCTARGCAWEE
SNSSGVPFCYFVSDLYSVSDVQYDSHGASAVISLKTSLYAYSFPSVPVNSLRLTVTYHKD
NMLQFKIYDPNNNRYEVPVPLNIPSVPSGTPESQLYAVLIKKNPFGIEIRRKSTGTVIWD
SQLLGFTFNDMFIRISTRLPSRYLYGFGETEHTAFRRDFGWNTWGMFSRDQPPGYKKNSY
GVHPYYMAMEEDGSAHGVLLLNSNAMDVTFQPLPALTYRTTGGILDFYVVLGPTPELVTQ
QYTELIGRPVMVPYWSLGFQLCRYGYRNDSEIASLYDAMVAAQIPYDVQYSDIDYMERQL
DFTLDAEFEGFPALITRMQANGMRVIIILDPAISGNETKPYLPFTRGVEDDVFIKDPSDG
SIVWGKVWPDFPDVVINSSLDWDSQVEKYRAFVAFPDFFRNSTIAWWKRELKELYTNPRE
PEKSLKFDGLWIDMNEPASFVNGAVFPGCKNATLNNPPYMPHLESRDRGLSSKTLCMESQ
QVLPDGSPVRHYDVHSLYGWAQTRPTYEAVQEVTGQRGIVITRSTFPSSGRWGGHWLGDN
TAAWDQLKKSIIGMMEFSLFGISYTGADICGFFQDAEYEMCARWMQLGAFYPFARNHNTI
GTRRQDPVSWNSTFVTISKSVLETRYTLLPYFYTLMHKASTEGSTVVRPLLHEFVSDRVT
WTLDSQFLLGPAFLVSPVLEANARDVTAYFPKARWYDYYTGMDIQSTGEWKSLPAPLDHI
NLHVRGGYVLPWQEPAQNTHLSRQKFLGFKVALDDEGTAEGWLFWDDGQSIDTYEKGLYY
LAHFSVSQNTMQSHIIFNKYISDTNPLRLGYFEVWGVGSDSISSVSISVSGVVITPTFSY
NSTTQVLNIDVTSRNISLHNFTSLTWGSTLNF
NT seq 5499 nt NT seq  +upstreamnt  +downstreamnt
atggcaagaaagaagctgaaaaagttcactactttggagcttatgctcagtattcttctg
cttgtggtgtttatcatcactattcccatctttgtgctttcagccagagattccctggaa
tcacaagatcctgggacgacagttagcccagatcctgggacaagcaccacccctggttct
gcagattgcccagtggtaaatgactcagaacggataaactgcatccctgaccaatcacca
acaaaggctacctgtgaccagcgtggctgttgctggagtcctcagggaaccataagtaag
ccctggtgctactattctaagaatcatggctatcaagtagggggcgacctcgtgaacaca
aatgcaggattcacagcccagctggaaaggttgtcttctccatctctgtttggaaatgat
gtcaacaatgtccttctcacagcagaataccagacatctaaccgtttccactttaagtta
actgaccaaaaccagaacagatacgaagtaccccatgaacacgtgcaacccttcacagga
aatgctgcctcttccttgacgtataaagttgaggtctccaaacagccgtttggcatcaaa
gtgatcagaacgagcaacaatcgtgttctgtttgactccagcgttgggcccctgctgttt
gctcaccagttcctgcagctctccatccgactgcctagtgccaacgtgtatgggctggga
gaacacgtgcaccagcagtaccggcatgacatgaactggaagacctggcccatatttgcc
agggacaccacccccaatggggatggaactaacttgtatggtgcgcagacattcttccta
tgccttgaagatgctagtggattgtcctttggagtgtttctgctgaacagcaatgccatg
gaggttttcctccagcccaccccagctatcacttaccgcaccattgggggcattctcgac
ttttatgtgttcttggggaatactccagagcaagtggttcaagaatacctagagctcatt
ggacggccagccctaccctcatactgggcgcttgggtttcatctcagtcgttatgactat
ggaaccctagagaacatgaaagaagtcgtggagagaaaccgcgctgcgcagctgccttat
gatgttcagcacgctgatattgattacatggaagcaagaaaggacttcacttatgatcca
gtagctttcaagggcttccctgagtttgttaaagaattacacagtaacggacagaaactg
gtcatcattgtggatcctgccatctccaacaactcttccctaagtaatccctatggcccg
tatgacaggggttcagatatgaagatatgggtgaatacttcagatggagtgactccactc
attggggaggtctggcctggaaaaactgtgtttcctgattacaccaaccctaagtgtact
gcttggtggacaaatgaatttgagcttttccacagtcaagtagagtttgatggaatctgg
attgatatgaatgaagtcgccaactttgtggatggctcagtttcaggatgttccacgagc
aatctaaattatcccccattcactcccaaaatcctggatgggtacctgttcagcaagagc
atctgcatggacgcagtgcagcactgggggcagcagtacgacgtccacaatctgtacggc
tactccatggccatcgccactgtagaaactgtcaagactgtgttccccaacaagagaagc
ctcattttaacccgttctacatttgcgggttctggcaagtttgcagcccactggttggga
gacaatgcagccacctggaacgacctccgatggtccatccctggcatgcttgagttcaac
ctttttggtatcccaatggtgggtgctgacatatgtggctttatactggatacgtctgaa
gagctctgcagacggtggatgcagctgggagcattctatccattttccaggaatcacaat
ggccaaggctacaaggcccaggatccagcctcctttggcaccaactcactgctgttgaat
tcctccaggcactacctgaccgtccgctatacccttctgccctatctctacaccctcttc
taccgtgctcacagccgcggggacaccgtggccaggccccttctgcatgagttctaccag
gacagcaacacctgggatgtgcaccagcagtttttatgggggcccggcctcctcatcact
ccagttctggatgagggtgcagagaaagtgaccgcatacatgcctgacgctgtctggtat
gactatgagactggggtccaagagagatggaggaagcaaaaagtggagatggaacttcct
ggagacaaaattggacttcacctgcgaggaggctacatcttccccacgcagcagccagcc
acgaccacggtggccagtcgacagaaccctcttggtctaatcattgccctggatgagaac
aaagaagcaaaaggcgaacttttctgggatgatggggaaacaaaagatactgtggccaac
aacctttatctcttatgtgagttctccgtcacccaaaaccgcctggaggttaagattttg
cagtcaacctacacagaccccaataatttggcatttaaagaaattaaaatccttggaacc
caggagcttaacaacgttgcagtgaaacagaacggtgttccaattcaagtttctcctaat
gtcacttacgattctaacctacaggtggcccttatcacaggaattgatcttgttctggga
ggaacatacacggtggagtgggatgtgaagatacgagatgaagaaaaaatagactgttat
cctgatgagactggtgtttctgcagaaaactgcactgcccgcggttgtgcctgggaggaa
tccaattcctctggagtccctttttgctatttcgtcagtgacctctactctgtcagtgat
gttcagtatgactcacacggggcctcagctgtcatctccttaaagacttctctgtatgcc
tactccttcccctcagtacctgtgaactccctccgcctgactgtgacctaccataaggat
aacatgctgcagtttaagatttatgatcccaacaacaaccgctatgaagttccagtccct
ctcaacatacccagtgttccatctggcacccctgagagtcaactctatgctgtcctcatc
aagaagaatccatttgggattgaaattcgccgcaaaagtacaggcactgtcatctgggac
tctcagctcctcggctttaccttcaatgacatgttcatccgcatctccacgcgcctcccc
tctcggtacctctatggtttcggggaaactgagcacacagccttccgaagagactttgga
tggaacacgtgggggatgttctctcgagaccaacccccggggtacaagaagaactcctat
ggtgtccacccctactacatggcaatggaggaggatggcagtgcccatggagtgcttctg
ctgaacagcaatgccatggatgtgaccttccagcccttgcctgccttgacataccgtacc
acaggaggaattctggacttttatgtggttttagggccaactccagagcttgtcactcag
cagtacactgagttgattggtcggccggtgatggttccttactggtccctggggtttcag
ctgtgtcgctatggataccggaacgactctgagatcgccagcttgtacgatgcgatggtg
gctgcacagatcccctatgatgtgcagtactccgacattgactacatggagcggcagctg
gacttcacccttgacgccgagtttgaggggtttccagctctgattactcgcatgcaggcc
aatgggatgcgagtcattatcattctggacccagccatttctggcaacgagaccaagccc
tatctgccattcacacggggtgtagaggatgatgtcttcatcaaagatccgagtgatggg
agcattgtctggggaaaggtctggcctgattttcctgatgtggtaataaacagttctcta
gactgggacagtcaagtggagaaataccgggcatttgtggcctttccagactttttccgt
aattcaaccatcgcatggtggaagagggagttgaaagaactgtacaccaatccacgggag
ccagagaagagcttgaagttcgatggcttgtggattgatatgaacgaaccagcgagcttc
gtgaatggagcagtctttccaggctgcaagaatgccactctgaacaaccctccctatatg
ccacatctggagtccagggaccggggcctgagcagcaagaccctgtgcatggagagccag
caggtcctgcctgacggctcaccggtgcgccactacgacgtgcacagcctctacgggtgg
gcccagaccagacccacatacgaagccgtgcaggaggtgaccggacagcgagggatcgtc
atcactcgctccactttcccctcttctggccgctggggaggacactggctgggagacaac
acggctgcgtgggaccagctgaagaagtcaatcattggcatgatggagtttagtctcttt
ggtatatcctacacaggagcagatatttgtggattctttcaagatgctgaatatgaaatg
tgtgctcgctggatgcaactaggggccttctaccccttcgcaaggaatcacaataccatt
gggaccaggaggcaagaccccgtgtcctggaattctaccttcgtgacaatctccaagagt
gtcctggagaccagatacaccctgttgccatatttctacaccctgatgcacaaggccagc
acagagggcagcactgtcgtgcggcctcttcttcacgagtttgtatcagaccgggtgacc
tggactctagacagtcagttcctgctgggcccagccttcctggtcagccctgtcctggag
gctaacgctagagatgtcactgcatatttccctaaagcccgctggtatgattactatacg
ggtatggacattcagtcgacgggtgagtggaagtccttgccggcgcctcttgaccacatt
aatcttcatgtccgtgggggctatgtcctgccctggcaagagcctgcacagaacacccac
ttaagccgtcagaaattcttaggtttcaaggttgccttggatgatgaggggactgctgaa
ggctggctcttctgggatgatgggcaaagcattgatacctatgaaaaaggactctattac
ctggcccacttttcagtcagccagaatacgatgcagagtcatataattttcaacaaatac
atcagtgatacaaaccctttgagactgggctactttgaggtctggggagtgggcagtgac
tccatatccagtgtcagcatctctgtgagtggcgtggttataacacccaccttctcctac
aactctacaacacaggtgttaaatattgatgtgaccagcagaaacatcagcctacataat
ttcacttcattgacatggggaagcacactgaatttttag

DBGET integrated database retrieval system