KEGG   Pantholops hodgsonii (chiru): 102321792Help
Entry
102321792         CDS       T02909                                 

Definition
(RefSeq) glutathione S-transferase omega-1-like
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00480  Glutathione metabolism
phd00980  Metabolism of xenobiotics by cytochrome P450
phd00982  Drug metabolism - cytochrome P450
phd00983  Drug metabolism - other enzymes
phd01100  Metabolic pathways
phd01524  Platinum drug resistance
phd05200  Pathways in cancer
phd05204  Chemical carcinogenesis
phd05225  Hepatocellular carcinoma
phd05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    102321792
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    102321792
   00982 Drug metabolism - cytochrome P450
    102321792
   00983 Drug metabolism - other enzymes
    102321792
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102321792
   05204 Chemical carcinogenesis
    102321792
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    102321792
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    102321792
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    102321792
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phd02000]
    102321792
Enzymes [BR:phd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     102321792
Transporters [BR:phd02000]
 Other Transporters
  Pores ion channels [TC:1]
   102321792
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C GST_C_2 Glutaredoxin
Motif
Other DBs
NCBI-GeneID: 102321792
NCBI-ProteinID: XP_005961598
LinkDB All DBs
Position
Un
AA seq 241 aa AA seqDB search
MSGGSARSLGKGSAPLGPVPEGLIRVYSMRFCPYAQRTRLVLTAKGIRHEVININLKNKP
EWFFKKNSSGLVPVLETSQGQLICESAITCEYLDEAYPEKKLLPGDPCEKACQKMVFESF
SKVPPLISRILRTQNKEDCSGLKEELHKEITKLEEVLTGKKTTFFGGNSLSMIDYLIWPW
FEHLEALELNECVDHTPALKLWMAAVKKDPTVSSLLTDVKTFQGFFNLYLQNSPEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgtccggaggatcagctaggagtctgggcaagggaagcgcgcccctcgggcccgtcccc
gagggcctgatccgtgtctacagcatgaggttctgcccgtatgcccagaggactcgcctg
gtcctgacggccaagggtatccggcatgaagtcatcaacataaatctgaaaaataagcct
gagtggttcttcaagaagaattcctcaggcctggtgccggttctggaaaccagtcagggt
caattgatctgtgaatctgccatcacttgtgagtacctggatgaagcatatccagagaag
aagctgttgccaggcgacccctgtgagaaagcttgccaaaagatggtctttgagtccttt
tctaaggtaccacctttgatatcgaggattcttagaacacaaaataaggaagactgctct
ggcctaaaagaagaattgcataaagaaatcaccaagctagaggaggttctgactggtaaa
aagacaaccttctttggtggcaattctctttctatgattgattacctcatctggccctgg
tttgaacacctggaagctctggagttgaatgagtgtgtagaccacactccagcccttaag
ctgtggatggcagccgtgaagaaggatcccacagtatcatctctcctcactgatgtgaag
acctttcaaggtttcttcaacctctacttgcagaacagccctgaggcttgtgactatggt
ctctga

DBGET integrated database retrieval system