KEGG   Pantholops hodgsonii (chiru): 102325764Help
Entry
102325764         CDS       T02909                                 

Gene name
SUV39H1
Definition
(RefSeq) suppressor of variegation 3-9 homolog 1
  KO
K11419  histone-lysine N-methyltransferase SUV39H [EC:2.1.1.43]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    102325764 (SUV39H1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:phd03036]
    102325764 (SUV39H1)
Enzymes [BR:phd01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     102325764 (SUV39H1)
Chromosome and associated proteins [BR:phd03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     102325764 (SUV39H1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    102325764 (SUV39H1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET Pre-SET Chromo
Motif
Other DBs
NCBI-GeneID: 102325764
NCBI-ProteinID: XP_005956991
LinkDB All DBs
Position
Un
AA seq 423 aa AA seqDB search
MEGMPCLRNDRLLXPLTGCSVCCKSSWNQLQDLCRLAKLSCPALGISKRNLYDFEVEYLC
DYKKIREQEYYLVKWRGYPDSESTWEPRQNLKCVRILKQFHKDLERELLRRHHRSKPPRH
LDPSLANYLVQKAKQRRALQRWEQELNAKRSHLGRITVENEVDLDGPPRAFVYINEYRVG
EGITLNQVAVGCECQDCLWAPAGGCCPGASLHKFAYNDQGQVRLRAGLPIYECNSRCRCG
YDCPNRVVQKGIRYDLCIFRTDDGRGWGVRTLEKIRKNSFVMEYVGEIITSEEAERRGQI
YXRXXXXYLFDLDYVEDVYTVDAAYYGNISHFVNHSCDPNLQVYNVFIDNLDERLPRIAF
FATRTIRAGEELTFDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRK
YLF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atggagggtatgccttgcctgagaaatgacagattgctgnngccactgacaggctgcagt
gtgtgttgcaaatcttcttggaatcagctacaggacctgtgccgcctggccaagctctcc
tgccctgcccttgggatctccaagaggaacctctatgactttgaagtcgagtacctgtgc
gattacaaaaagatccgcgaacaggagtattacctggtaaaatggcgtgggtacccagac
tccgagagcacctgggaaccacggcagaatctgaagtgtgtgcgcattctcaagcagttc
cacaaggacttggaaagggagctgctccggcggcaccaccggtcgaagccaccccggcac
ctggacccaagcctggccaactacctggtacagaaggccaagcagaggcgggcactccag
cgctgggagcaggagctcaatgccaagcgcagccacctgggacgcatcaccgtggaaaac
gaagtggacctggatggccccccacgggccttcgtgtacatcaacgaataccgtgttggt
gagggcatcaccctaaaccaggtggctgtgggctgcgagtgccaggactgtctgtgggca
ccggctggaggctgctgccccggggcatcactgcacaagtttgcctacaatgaccagggc
caggtgcgcctgcgagccgggctgcccatctacgagtgcaactcccgctgccgctgtggc
tatgactgccccaaccgagtggtacagaagggcatccgctacgacctctgcatcttccgc
acggatgatggacgtggctggggtgtccgcacgctggagaagatccgcaagaacagtttc
gtcatggagtacgtgggcgagatcattacctcagaggaggcagagcggcgggggcagatc
tattaacgccnnnnnnnnnnctacctcttcgacctggactacgtggaggatgtgtacact
gtggacgccgcctattacggcaacatctcccactttgtcaaccacagttgtgaccccaac
ctccaggtgtacaacgtcttcatagacaaccttgatgagcggctgccccgcattgctttc
tttgccaccagaaccatccgggcaggcgaggagctcacctttgattacaacatgcaagtg
gaccccgtggacatggagagcacacgcatggactccaactttggcctggctgggctccct
ggctctcccaagaagcgggtccgcatcgaatgcaagtgtgggactgaatcctgccgcaaa
tacctcttctag

DBGET integrated database retrieval system