KEGG   Pantholops hodgsonii (chiru): 102326739Help
Entry
102326739         CDS       T02909                                 

Gene name
SOD2
Definition
(RefSeq) superoxide dismutase 2
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04068  FoxO signaling pathway
phd04146  Peroxisome
phd04211  Longevity regulating pathway
phd04213  Longevity regulating pathway - multiple species
phd05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    102326739 (SOD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    102326739 (SOD2)
 09150 Organismal Systems
  09149 Aging
   04211 Longevity regulating pathway - mammal
    102326739 (SOD2)
   04213 Longevity regulating pathway - multiple species
    102326739 (SOD2)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    102326739 (SOD2)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     102326739 (SOD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102326739
NCBI-ProteinID: XP_005980477
LinkDB All DBs
Position
Un
AA seq 384 aa AA seqDB search
MRSTDAAFFPSAAPSDDASACWRARCKSPEDGFRQRMRAVPGTWRVHSNTLSGLAEVPRS
VHSERTLTPGSSCRGTGPTPSQGQGPLSCETASAHGCAPKRLPETLPFPLGEGPGTPRLP
RPDPTPPYPSGVREGAGTEPRAIPRHARGGRVPHPRAALGESRWVCSLCSTSRKLVPALG
VLGSRQKHSLPDLPYDYGALEPHINAQIMQLHHSKHHAAYVNNLNVAEEKYREALEKGDV
TAQIALQPALRFNGGGHINHSLFWTHLSPNGGGEPKGELLEAIKRDFGSFAKFKEKLTAV
SVGVQGSGWGWLGFNKEQGRLQIAACSNQDPLQGTTGLIPLLGIDVWEHAYYLQCKNVRP
DYLKAIWNVINWENVTARYTACSK
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgcgctccacggacgcggctttcttcccctcggctgcgcccagcgatgatgcttccgcg
tgctggcgggccaggtgcaagtctcctgaggacggctttaggcagcgaatgcgcgcagtc
cctggcacgtggcgggtgcacagtaacactttatcaggcctggcggaggtcccaaggtcg
gttcactcggaaagaacgctcactcccggcagtagttgcagaggcaccggccctacaccg
tcccagggccagggcccgctttcctgcgagaccgcgtcggctcacggctgcgctccgaag
cggctcccagaaacactacccttccctctgggcgaagggcccgggaccccgaggctaccc
cgacccgacccgaccccaccctacccgagcggcgtccgggaaggagcaggaactgagcca
cgggcaattccccggcacgcccgcgggggccgggtcccccacccgcgggccgcgctgggc
gaatcgcgctgggtgtgctctctctgcagcacgagcaggaaactggtgccggccctgggc
gtgctgggctcccggcagaagcacagcctccccgacctgccgtacgactacggcgccctg
gagccgcacatcaacgcgcagatcatgcagctgcaccacagcaagcaccacgcggcctac
gtgaacaacctcaacgtcgccgaggagaagtaccgggaggcgctggagaagggtgatgtc
acagctcagatagctctgcagcctgcgttaaggttcaacggtgggggccatatcaatcac
agcctcttctggacacatctgagccctaacggtggtggagaacccaaaggggaattgctg
gaagccatcaaacgtgactttggttcctttgccaaatttaaggaaaagctgactgctgta
tctgttggtgtccaaggttccggttggggttggcttggcttcaataaggagcagggacgc
ttacagattgctgcttgttctaaccaggatcccctgcaaggaacaacaggtcttatcccc
ctgctggggattgatgtgtgggagcatgcttattaccttcagtgtaaaaatgtcaggccc
gattatctgaaggccatttggaatgtgatcaactgggagaatgtaactgcacgatacacg
gcttgcagcaagtaa

DBGET integrated database retrieval system