KEGG   Pantholops hodgsonii (chiru): 102326835Help
Entry
102326835         CDS       T02909                                 

Gene name
HDAC6
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd05034  Alcoholism
phd05165  Human papillomavirus infection
phd05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:phd00001]
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    102326835 (HDAC6)
  09164 Substance dependence
   05034 Alcoholism
    102326835 (HDAC6)
  09167 Infectious diseases
   05165 Human papillomavirus infection
    102326835 (HDAC6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:phd01009]
    102326835 (HDAC6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:phd03019]
    102326835 (HDAC6)
   04131 Membrane trafficking [BR:phd04131]
    102326835 (HDAC6)
   03036 Chromosome and associated proteins [BR:phd03036]
    102326835 (HDAC6)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     102326835 (HDAC6)
Protein phosphatases and associated proteins [BR:phd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102326835 (HDAC6)
Messenger RNA biogenesis [BR:phd03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     102326835 (HDAC6)
Membrane trafficking [BR:phd04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    102326835 (HDAC6)
Chromosome and associated proteins [BR:phd03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     102326835 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 102326835
NCBI-ProteinID: XP_005956992
LinkDB All DBs
Position
Un
AA seq 1129 aa AA seqDB search
MTSTGQDSTTPKERRSRHNPHSPTHDSSITSKRGIKKGAILRSSPSLAEVKKKGRMKKLN
QTAEQDLIMGLQGLNLNLEARTLSGTGLVFDEQLNEFHCLWDDSFPERPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELHVLADTYDSVYLHPNS
YTCACLASGSVLRLVDAVLEAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHDIQRVLIVDWDVHHGQGIQFAFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGLGQG
QGYTINVPWNQVGMQDADYIAAFLHVLLPVAFEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAEGKLILSLEGGYNLRSLAEGVSASLHTLLGDPCPMLESPGAPCLSA
QASLSCALEALEPFWESLVRSVESLEEKDTVEKDDVEEKEEEKLPQSSELSVPIWPVLQA
RTGLVYDQRMMEHYNLWDNYHPEMPQRIHCIMHHLDELGLAKRCHSLPARPATDAELLTC
HSAEHLERLRATEKMKTRELRREGANYDSIYICSSTFACAQLAAGAACRLVEAVLAGEVL
NGVAVVRPPGHHAEPDAACGFCFFNSVAVAARHAQAISGHALRILIVDWDIHHGNGTQHI
FEEDPSVLYISLHRYDHGTFFPMGNEGACTRIGKATGTGFTVNVAWNGPRMGDADYLAAW
HRLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLANGHIILILE
GGYNLTSISESMAACTRSLLGDPLPLLTRLRPPLSGAQDSITKTIQVHRRYWRSLRVMKR
KNIEGLSSSKLITKKPSQPASSELANVTTTVEGNILGAGMGQAASEASVKESTPDQTESA
TAPVELTQGQSSDTATQGAALDQTISEGATGGAELIQNPPASCINNRIPPALPVQRATTQ
TSPSKLTANLRILDLDSTTQEPSEEEGLLGEAAGGQDTNESVPVQVFGDHADTDQVMFYA
VRPLLWCPHLAAVCPIPETGLNVTQPCQDCGTLQENWVCLSCYQIYCGRYINAHMLQHHE
GSGHPLVLSYADLSAWCYHCQAYVHHKDLLAVKNIAHQNKFGEDIPHSD
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
atgacctccaccggtcaggattccaccacacccaaggagcgaaggagtaggcacaatccc
cactcccccacccatgactccagcatcacctcgaagcgaggtattaaaaagggtgctata
ctccgctccagccccagtctagcggaggtaaagaagaaaggcagaatgaagaagcttaac
caaacagccgagcaagacctaatcatggggctgcaagggctgaatctgaacctggaggcc
aggacactgtctggcactggcttggtgttcgatgaacagctaaatgaattccactgcctc
tgggatgacagcttcccggaacgcccagagcggctccatgccatcaaggagcaactgatc
caggagggcctcctggaccgctgcgtgtcgtttcaggcccgattcgccgaaaaggaggag
ctgatgttggttcacagcctagaatatattgatctgatggaaacgacccagtacatgaac
gagggggagctccacgtcctcgcagatacctatgactcagtttatctgcatccgaactca
tacacttgtgcctgcctggcctcaggctctgtcctcaggctggtggatgcagtcctggag
gctgagatccggaatggcatggccatcatcaggcctcctggacaccatgcccagcacagt
ctcatggatggatattgcatgttcaaccacgtggccgtggctgcccgttatgctcaacag
aagcatgatattcagagggtccttatcgtggattgggatgtgcaccatggtcagggaata
cagttcgcctttgaccaagatcctagtgtcctctatttctccatccaccgctatgagcaa
ggtcggttctggccccatcttaaggcctctaattggtccaccacaggtttaggccaaggc
cagggatacaccatcaacgtgccttggaaccaggtggggatgcaagatgctgactacatt
gccgctttccttcacgtcctcctgccagtcgcatttgagttccagccccagctggtcctg
gtagccgctggatttgatgccctccaaggggaccccaagggtgagatggctgccactcca
gcagggttcgcccagctcacccatctgctcatgggtctggcagaaggcaagctgatcctc
tcactggagggtggctataatctccgctctctggctgaaggtgtcagcgcctccctccac
acccttctgggtgacccttgtcctatgttagagtctcctggtgccccctgcctgagtgcc
caggcgtcactctcctgtgctctagaagccctggaacccttctgggagagccttgtgaga
tcagttgagagcctggaagaaaaggacactgtggagaaggatgatgtggaagagaaggag
gaagagaaactgccacagtcctctgagctctccgttccgatatggccggtgctgcaggct
cgcacggggttggtctatgaccaacggatgatggagcactacaacttgtgggataactac
caccctgagatgccccagcgcatccactgtatcatgcatcacctggacgaactgggcctt
gccaagcgctgccactccctgcccgcaaggcccgctacagatgctgagctgctcacctgc
cacagtgctgaacacttggaacgtctgcgggccacggagaagatgaagacccgggagctg
cgccgtgagggcgccaactatgactccatctacatctgctccagcacttttgcctgcgca
cagctggctgcaggcgccgcctgtcgcctggtggaggcagtactggcaggagaggtcttg
aatggtgttgctgtagtgcgacctcctggccaccatgcagagccggatgcagcttgtggt
ttctgtttttttaattctgtggctgtggctgctcgccatgcccaggccatcagtgggcat
gcactgcggatcctgatcgtggactgggacatccatcatggtaatggaactcagcacata
tttgaggaggaccccagtgtgctgtacatttccctgcaccgctatgatcatggtaccttc
tttcccatggggaatgagggtgcctgtacccggataggtaaagctacaggcacaggattc
actgtcaatgtggcctggaatgggccccgcatgggtgatgctgactacctggctgcctgg
caccgtctggttcttcccattgcttatgagtttaacccagaactggtgctggtctcagct
ggtttcgacgctgctcggggggatcctctgggcggctgccaggtgtcgcctgagggctat
gcccacctcacccacctgctgatgggtttggccaatggccatatcatcctaatcctagag
ggtggctataacctgacgtccatctcagagtccatggctgcctgcactcgctccctcctt
ggggatccactgcccctgctgacccggctgcggcccccactatctggagcccaggattct
atcactaaaaccatccaagtccatcgaagatactggcgcagtttgcgggtcatgaagcgc
aaaaacatagagggactgtccagttctaagttgatcaccaagaagccatcccaaccagcc
agttctgagttagccaatgtgacgaccacagtggaagggaacatcctgggggcaggcatg
ggacaggccgcctcagaagcatctgtgaaagagtccactccagatcagactgagtcagcg
acagctccagtagaacttactcagggccagtcctcagacacagccacacaaggagctgca
ctggaccagaccatctcagagggggccacaggaggagctgagctgatccaaaaccctcca
gcctcatgcatcaacaacaggattcctcctgccttacccgtgcaaagagccacaacccag
acatcccctagtaagctgacggcaaacctcagaatattggacctagatagcacgactcag
gagccctcagaagaggaaggactactaggagaggcagctggaggtcaggacacaaatgag
tcagtgccagtgcaggtctttggagatcatgctgacactgaccaggtcatgttttatgct
gtgagaccactgctttggtgtcctcatttggcggcagtatgccccatacctgagacaggg
ctgaatgtgacccaaccttgtcaggactgtggaacactccaagagaactgggtgtgtttg
tcttgctatcagatctactgtggtcgttacatcaatgctcatatgctccaacaccatgaa
ggttcgggacacccactcgtactcagctatgccgacctgtctgcctggtgttaccactgt
caggcctatgtccaccacaaggatctcctagcagtgaagaacatcgcccaccagaacaag
tttggggaagacataccccattcagactaa

DBGET integrated database retrieval system