KEGG   Pantholops hodgsonii (chiru): 102326874Help
Entry
102326874         CDS       T02909                                 

Gene name
PTGS2
Definition
(RefSeq) prostaglandin-endoperoxide synthase 2
  KO
K11987  prostaglandin-endoperoxide synthase 2 [EC:1.14.99.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00590  Arachidonic acid metabolism
phd01100  Metabolic pathways
phd04064  NF-kappa B signaling pathway
phd04370  VEGF signaling pathway
phd04625  C-type lectin receptor signaling pathway
phd04657  IL-17 signaling pathway
phd04668  TNF signaling pathway
phd04723  Retrograde endocannabinoid signaling
phd04726  Serotonergic synapse
phd04913  Ovarian steroidogenesis
phd04921  Oxytocin signaling pathway
phd04923  Regulation of lipolysis in adipocytes
phd05140  Leishmaniasis
phd05163  Human cytomegalovirus infection
phd05165  Human papillomavirus infection
phd05167  Kaposi sarcoma-associated herpesvirus infection
phd05200  Pathways in cancer
phd05204  Chemical carcinogenesis
phd05206  MicroRNAs in cancer
phd05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102326874 (PTGS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04370 VEGF signaling pathway
    102326874 (PTGS2)
   04064 NF-kappa B signaling pathway
    102326874 (PTGS2)
   04668 TNF signaling pathway
    102326874 (PTGS2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    102326874 (PTGS2)
   04657 IL-17 signaling pathway
    102326874 (PTGS2)
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    102326874 (PTGS2)
   04913 Ovarian steroidogenesis
    102326874 (PTGS2)
   04921 Oxytocin signaling pathway
    102326874 (PTGS2)
  09156 Nervous system
   04726 Serotonergic synapse
    102326874 (PTGS2)
   04723 Retrograde endocannabinoid signaling
    102326874 (PTGS2)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    102326874 (PTGS2)
   05206 MicroRNAs in cancer
    102326874 (PTGS2)
   05204 Chemical carcinogenesis
    102326874 (PTGS2)
  09162 Cancers: Specific types
   05222 Small cell lung cancer
    102326874 (PTGS2)
  09172 Infectious diseases: Viral
   05163 Human cytomegalovirus infection
    102326874 (PTGS2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    102326874 (PTGS2)
   05165 Human papillomavirus infection
    102326874 (PTGS2)
  09174 Infectious diseases: Parasitic
   05140 Leishmaniasis
    102326874 (PTGS2)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102326874 (PTGS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 102326874
NCBI-ProteinID: XP_005963446
LinkDB All DBs
Position
Un
AA seq 604 aa AA seqDB search
MLARALLLCAAVALCGAANPCCSHPCQNRGVCMSVGFDQYKCDCTRTGFYGENCTTPEFL
TRIKLLLKPTPDTVHYILTHFKGVWNIVNKISFLRNMIMRYVLTSRSHLIESPPTYNVHY
SYKSWEAFSNLSYYTRALPPVPDDCPTPMGVKGRKELPDSKEVVKKVLLRRKFIPDPQGT
NLMFAFFAQHFTHQFFKTDFERGPAFTKGKNHGVDLSHVYGESLERQHKLRLFKDGKMKY
QMINGEMYPPTVKDTQVEMIYPPHIPEHLKFAVGQEVFGLVPGLMMYATIWLREHNRVCD
VLKQEHPEWGDEQLFQTSRLILIGETIKIVIEDYVQHLSGYHFKLKFDPELLFNQQFQYQ
NRIAAEFNTLYHWHPLLPDVFQIDGQEYNYQQFIYNNSVLLEHGVTQFVESFTRQIAGRV
AGGRNLPVAVERVSKASLDQSREMKYQSFNEYRKRFLLKPYESFEELTGEKEMAAELEAL
YGDIDAMELYPALLVEKPRPDAIFGETMVEAGAPFSLKGLMGNPICSPEYWKPSTFGGEV
GFKIINTASIQSLICSNVKGCPFTSFSVQDAHLTKTVTINASSSHSGLDDINPTVLLKER
STEL
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcccgggccctgctgctctgcgccgccgtggcgctctgcggtgcagcaaatcct
tgctgttcccatccatgccagaatcgaggtgtatgtatgagtgtaggatttgaccagtat
aaatgtgactgtacccgaacaggattctatggtgaaaactgtaccacacctgaatttctg
acaagaataaaattactcctgaaacccactcccgacacagtgcactacatacttacccac
ttcaagggagtctggaacattgtcaataagatctccttcctgcgaaatatgattatgaga
tacgtgttgacgtcgagatcacatttgattgagagtccaccaacttataatgtgcactac
agctataaaagctgggaagccttttctaacctgtcctattataccagagctcttcctcct
gtgcctgatgactgcccaacacccatgggtgtgaaagggaggaaagagcttcctgattcg
aaagaagttgtgaaaaaagtacttctaagaagaaagttcattcctgatccccagggcaca
aatctgatgtttgcattctttgcccagcacttcacccatcaatttttcaagacagatttt
gaacgaggaccagctttcactaagggaaagaaccatggggtggacttaagtcatgtttat
ggtgaatctttagagagacagcataagctgcgccttttcaaggatggaaaaatgaaatat
cagatgattaacggagagatgtatcctcccactgtcaaagatactcaggttgaaatgatc
tacccgcctcatattcctgaacacttgaagtttgctgtgggccaggaggtctttggtctg
gtgcctggtctgatgatgtatgccaccatttggctgcgggaacataacagagtatgtgat
gtacttaaacaagagcatccagaatggggcgatgagcagttgttccagacaagtaggcta
atcctgataggagaaactattaagattgtgattgaagactacgtacagcacttgagtggc
tatcacttcaaactgaagtttgacccagagctgcttttcaaccaacagttccagtaccaa
aaccgtattgctgctgagtttaacacgctctaccactggcatccccttctgcctgacgtc
tttcagattgatggccaggagtacaactatcagcagtttatctataacaactctgtctta
ctggaacatggtgtcactcagtttgttgaatcatttaccaggcaaattgctggcagggtc
gctggtggtaggaatcttccagtcgcagtagagagagtatcaaaggcttcacttgaccag
agcagagagatgaaataccagtcttttaatgagtatcgcaaacgttttctgctgaagccc
tatgaatcatttgaggaacttacaggagagaaggaaatggctgcagagttagaagcgctc
tacggagacatagatgccatggagctgtatcccgcccttctggtagagaagccccgtccc
gacgccatctttggggagaccatggtagaagccggggcaccattctccctgaaaggactt
atgggtaatcctatatgttctcctgagtactggaagcctagcactttcggtggagaagta
ggttttaaaatcatcaacactgcctcaattcagtctctcatctgcagtaacgtgaaaggc
tgtccctttacctcattcagtgttcaagatgcacacctcaccaaaacggtcaccattaac
gcaagctcttcccactcgggactagacgatatcaaccccacagtcctactaaaggaacgt
tcaaccgaactgtag

DBGET integrated database retrieval system