KEGG   Pantholops hodgsonii (chiru): 102326929Help
Entry
102326929         CDS       T02909                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn], chloroplastic-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu Ribosomal_60s
Motif
Other DBs
NCBI-GeneID: 102326929
NCBI-ProteinID: XP_005973484
LinkDB All DBs
Position
Un
AA seq 225 aa AA seqDB search
MAAARNAPHNFSSTDINQEIATMRLNASPSTPSTAVKLLMAAGMVLALGACGSQSKPPAA
AAASTPAAVTAAPAARNVAMAQLQPTQGSKVSGSLQFTAQADGSVRVQGSVQGLAPNSEH
GFHVHEKGDCSSPDGLSAGGHFNPTGHAHGRFDSAVHHAGDLPSLRSDAQGMASIDFVSR
GLALDQSPNSVVGRGLIVHKDPDDYTTQPTGNSGARLACAVITRG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcgcgcaatgcgcctcacaacttttccagcacggatatcaaccaggagatt
gccaccatgcgtttgaacgcttccccctccaccccgtccaccgccgtgaagctgctgatg
gcagccggcatggtgctggcccttggggcctgcggcagccagtccaagcctcctgccgca
gccgcggcgtccaccccggcagccgtcaccgcagcccctgccgcccgcaacgtggccatg
gcccagctgcagcccacgcaaggcagcaaggtcagcggcagcctgcagttcactgcccag
gccgatggcagcgtgcgcgttcagggctcggttcaggggctggcgcccaacagcgagcat
ggctttcatgtccatgagaaaggcgattgctccagccctgatggcctgagcgcgggcggc
catttcaaccccaccggccacgcccatggccgcttcgattccgctgtccaccacgcaggg
gatctgcccagcctgcggtccgacgcgcaaggcatggccagcatagatttcgtttcgcgc
ggcctggcactggatcagagtcccaacagcgtggtgggccgcggcctgatcgtgcacaag
gaccctgacgactacaccacgcagcccaccggcaattccggggcgcgcctggcctgtgcg
gtgatcacgcgcggatga

DBGET integrated database retrieval system