KEGG   Pantholops hodgsonii (chiru): 102327372Help
Entry
102327372         CDS       T02909                                 

Gene name
ABAT
Definition
(RefSeq) 4-aminobutyrate aminotransferase
  KO
K13524  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00250  Alanine, aspartate and glutamate metabolism
phd00280  Valine, leucine and isoleucine degradation
phd00410  beta-Alanine metabolism
phd00640  Propanoate metabolism
phd00650  Butanoate metabolism
phd01100  Metabolic pathways
phd04727  GABAergic synapse
Module
phd_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    102327372 (ABAT)
   00650 Butanoate metabolism
    102327372 (ABAT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    102327372 (ABAT)
   00280 Valine, leucine and isoleucine degradation
    102327372 (ABAT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    102327372 (ABAT)
 09150 Organismal Systems
  09156 Nervous system
   04727 GABAergic synapse
    102327372 (ABAT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:phd01007]
    102327372 (ABAT)
Enzymes [BR:phd01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     102327372 (ABAT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     102327372 (ABAT)
Amino acid related enzymes [BR:phd01007]
 Aminotransferase (transaminase)
  Class III
   102327372 (ABAT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aminotran_3 Lenti_VIF_2 Tex_N
Motif
Other DBs
NCBI-GeneID: 102327372
NCBI-ProteinID: XP_005984717
LinkDB All DBs
Position
Un
AA seq 500 aa AA seqDB search
MASMLLTQRLVCSFQHNYRLLVPGSRHISQAAAKVDVEFDYDGPLMKTEVPGPRSRELMK
QLNIIQNAEAVHFFCNYEESRGNYLVDVDGNRMLDLYSQISSVPIGYNHPALMKLVQQPQ
NMSTFINRPALGILPPENFVEKLRESLLSVAPKGMSQLITMACGSCSNENAFKTIFMWYR
SKERGQSSFSKEELETCMVNQAPGCPDYSILSFMGAFHGRTMGCLATTHSKAIHKIDIPS
FDWPIAPFPRLKYPLEEFVKENQQEEARCLEEVEDLIVKYRKKKRTVAGIIVEPIQSEGG
DNHASDDFFRKLRDISRKHGCAFLVDEVQTGGGCTGKFWAHEHWGLDDPADVMTFSKKMM
TGGFFHKEELRPNAPYRIFNTWLGDPSKNLLLAEVINVIKREDLLKNAAHAGKVLLTGLL
DLQARFPQLISRVRGRGTFCSFDTPDESVRNKLISIARNKGLMLGGCGDKSIRFRPTLVF
RDHHAHLFLNIFSDILADFK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atggcctccatgttgctcacccagcggctggtctgcagcttccagcacaactaccgcctg
ttggtgccgggttccagacacatcagtcaggctgcagccaaagtcgacgttgaatttgac
tatgatggacctttgatgaagacggaagtcccagggcctagatctcgggagctaatgaaa
cagttgaatataattcagaatgcagaggctgtgcactttttctgcaattatgaagaaagt
cgaggcaattacctggtggatgtggatggcaaccggatgttggatctttattcccagatc
tcctctgtccctataggttacaaccatcctgctctcatgaaacttgtccaacagcctcaa
aatatgagcactttcatcaacagacctgccctcggaatccttcctccggagaactttgtg
gagaagctccgggagtccctgctctcggtggctcccaaagggatgtcccagctcatcaca
atggcctgcggctcctgctccaacgagaacgccttcaagaccatcttcatgtggtacagg
agcaaggaaaggggccagtcgagtttctccaaagaggagctggagacgtgcatggtcaac
caggcccctgggtgccctgactacagcatcctctccttcatgggtgctttccacgggagg
accatgggttgcttagcaaccacacactccaaagccattcacaagatcgacatcccctcc
ttcgactggcccatcgcaccattcccacggctgaaatatcctctggaagagtttgtgaaa
gagaaccaacaagaggaggcccgctgtctagaagaggtggaggacctgatcgtgaaatac
cggaagaagaagaggacagtggccggcatcattgtggaacccatccagtctgagggtgga
gacaaccacgcgtcggatgacttcttccggaagctgagagacatctccaggaagcacggc
tgtgccttcttggtggacgaggtccagactggaggaggctgcaccggcaagttctgggcc
cacgagcactggggcttggatgacccggcggacgtgatgaccttcagcaagaagatgatg
actgggggcttcttccacaaggaggagttgcggcccaacgctccttaccggatcttcaac
acgtggctgggagacccgtccaagaacctgctgctggccgaggtcatcaacgtcatcaag
cgagaggacctgctgaaaaacgcagcccatgctgggaaggtcctgctcacgggactgctc
gacctccaggcccggttcccccagctcatcagcagagtcagagggcgaggcaccttctgc
tccttcgacactccagatgaatctgtgcggaataaactcatttcaatagccaggaacaaa
ggcctgatgctggggggctgcggcgacaagtccatccgcttccgtcccactctggtcttc
cgagatcaccacgcacacctgttcctcaacatctttagtgacatcctagctgacttcaag
taa

DBGET integrated database retrieval system