KEGG   Pantholops hodgsonii (chiru): 102328312Help
Entry
102328312         CDS       T02909                                 

Definition
(RefSeq) alanine racemase, catabolic-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-GeneID: 102328312
NCBI-ProteinID: XP_005981312
LinkDB All DBs
Position
Un
AA seq 293 aa AA seqDB search
MPRPILATIHSAALRHNLERVRQAVPDAKLWAVVKANAYGHGIENVFEALRGADGFAMLD
LAEAERVRQLGWRGPILLLEGVFEPRDLELCSRLSIWHAVHCDAQIDWLAAHKTQNGHRV
FLKMNSGMNRLGFTPERFRAAWARLNALPQVEEISFMTHFSDADAGSGQSGISAQLQRFH
DATCDLPGERSVGNSAATLRHGDDAQVRCDWVRPGIVLYGSSPDYPQHTAAHWGLQPTQT
LSSRIIGVQQLAAGQSVGYGSRFTAEAPVRLGTVACGYADGYPRHCGTGTPVL
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgccgcgtcccattcttgccaccatccattccgccgcgcttcgccacaatctggagcgg
gtgcggcaagcggtccccgatgccaaattgtgggccgtggtcaaagccaacgcctatggc
cacggtatcgaaaacgtgttcgaggccctgcgcggcgccgacggcttcgccatgctggac
ctggccgaggccgagcgcgtgcgccagctgggctggcgcggccccatcctgctgctggag
ggcgtgttcgagccgcgcgacctggagctttgctcgcgcctgtccatctggcatgccgtg
cattgcgacgcccagatcgactggctggccgcgcacaagacgcagaacggccaccgcgtc
ttcctcaagatgaactccggcatgaaccgcctgggcttcacgcccgagcgctttcgcgcg
gcctgggcccggctcaatgccttgccccaggtggaggaaatctcgttcatgacccacttc
agcgatgccgacgcaggctctggccagtcgggcatctccgcgcagctgcagcgctttcac
gacgccacgtgcgacctgcccggcgagcgcagcgtgggcaacagtgccgccacgctgcgc
catggcgacgatgcccaggtgcgctgcgactgggtgcggcccggcatcgtgctgtacggc
agctcgcccgactatccgcagcacacggcggcccattggggcctgcagcccacgcagacc
ctgagctcgcgcatcatcggcgtgcagcagctggctgcggggcagagcgtgggctatgga
tcgcgcttcacggccgaagctcccgtgcgcctgggcaccgtggcctgcggctatgccgac
ggctatccgcgccactgcggcaccggcacgcccgtgctg

DBGET integrated database retrieval system