KEGG   Pantholops hodgsonii (chiru): 102328580Help
Entry
102328580         CDS       T02909                                 

Definition
(RefSeq) superoxide dismutase [Fe], chloroplastic-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 102328580
NCBI-ProteinID: XP_005968445
LinkDB All DBs
Position
Un
AA seq 208 aa AA seqDB search
MTTITLPALPYGYEDLAPHISKETLEFHHDKHHNTYVVNLNNLIKGTDLEGKTLEEIIVA
VAGDASKAGVFNNAAQVWNHTFYWNCMAKNGGGKATGALAAKIDEAFGSYEKFAEEFAAA
ATTQFGSGWAWLVADKVNGELSILKTSNADTPLAHGKVAVLTIDVWEHAYYIDFRNARPK
YISTFLESLVNWDYANAKYAGQEAGVEK
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccattactttacctgctttaccatacggctatgaagatcttgcgccgcacatc
agcaaagaaactttagaattccatcatgacaagcaccacaatacttatgttgtaaactta
aacaacttaatcaagggtactgatcttgaaggtaaaactttagaagagatcattgttgct
gttgctggcgatgcttctaaagcaggtgtattcaacaacgctgcacaagtttggaaccac
acattctactggaactgtatggctaaaaacggtggcggtaaagcaactggcgctttagct
gctaaaattgatgaagctttcggttcttacgaaaaattcgctgaagaattcgctgctgct
gcaacaactcaattcggttcaggttgggcttggttagttgctgataaagtgaatggcgaa
ctttctattcttaaaacttcaaatgcagatactccacttgcacatggcaaagtagcagta
cttacaattgacgtttgggaacatgcttattacatcgacttccgtaatgctcgtcctaaa
tacatttcgactttcttagaaagccttgtaaactgggactatgcaaacgcgaaatatgcc
ggccaagaagctggtgttgaaaaataa

DBGET integrated database retrieval system