KEGG   Pantholops hodgsonii (chiru): 102328995Help
Entry
102328995         CDS       T02909                                 

Definition
(RefSeq) elongation factor Tu, mitochondrial-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 102328995
NCBI-ProteinID: XP_005977861
LinkDB All DBs
Position
Un
AA seq 396 aa AA seqDB search
MAKEKFERNKPHCNIGTIGHVDHGKTTLTAAITMVLAKTGGATAKKYDEIDAAPEEKARG
ITINTAHVEYETQNRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDAELLDLVEMEVRELLSSYDFPGDDIPIVKGSALAAVE
GREPAIGEDRILELMTQVDAYIPQPDRPIDQPFLMPVEDVFSISGRGTVVTGRIEKGIVK
VGEEVEIVGLRATQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGS
ITPHTKFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIVRLKEGVEMIMPGDNAE
LNVELITPIAMDQGLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttcgaacgcaacaagccgcactgcaacatcggcacgattggtcac
gttgaccacggcaagacgacgctgacggcggcgatcacgatggtgctggccaagacgggc
ggcgcgacggcgaagaagtacgacgagatcgacgcggcgccggaagagaaggcgcgtggg
atcacgatcaacacggcgcacgtggaatatgagacgcagaaccgtcactatgcgcacgtg
gactgccctgggcacgccgactatgtgaagaacatgatcacgggcgcggcgcagatggac
ggcgcgatcctggtggtttcggcggcggacggcccgatgccgcagacgcgcgagcacatc
ctgctggcgcgccaggtcggggttccggcgctggtggtgttcatgaacaaggtcgacatg
gtcgacgacgccgaactgctcgacctggtcgagatggaagtgcgcgaactgctgtcgagc
tacgacttcccgggcgacgacattccgatcgtgaagggctcggccctggcggcggttgaa
ggccgcgagccggcgatcggcgaggaccgcatccttgagctgatgacgcaggtcgacgcc
tacatcccgcagccggaccgtccgatcgaccagccgttcctgatgccggtggaagacgtg
ttctcgatctcgggccgcggcacggtggtgaccggccggatcgagaaggggatcgtcaag
gtcggcgaggaagtggagatcgtgggtctgcgggcgacgcagaagacgacctgcacgggc
gtggagatgttccgcaagctgctggaccagggccaggcgggcgacaacgtcggcgtgctg
ctgcgcggcaccaagcgtgaagacgtcgagcgcggccaggtgctgtgcaagccgggttcg
atcacgccgcacaccaagttcgtggccgaggcctatatcctgaccaaggaagaaggcggc
cgtcacacgccgttcttcaccaactaccgtccgcagttctacttccggacgacggacgtg
accgggatcgtgcgcctgaaggaaggcgtggagatgatcatgccgggcgacaacgccgag
ctgaacgtcgagctgatcacgccgatcgcgatggaccagggcctgcgcttcgccatccgc
gaaggcggccgtacggtcggcgcgggcgtggtggccaagatcgtcgagtaa

DBGET integrated database retrieval system