KEGG   Pantholops hodgsonii (chiru): 102329724Help
Entry
102329724         CDS       T02909                                 

Gene name
OGDHL
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00020  Citrate cycle (TCA cycle)
phd00310  Lysine degradation
phd00380  Tryptophan metabolism
phd01100  Metabolic pathways
phd01200  Carbon metabolism
Module
phd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phd_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102329724 (OGDHL)
  09105 Amino acid metabolism
   00310 Lysine degradation
    102329724 (OGDHL)
   00380 Tryptophan metabolism
    102329724 (OGDHL)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     102329724 (OGDHL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 102329724
NCBI-ProteinID: XP_005960999
LinkDB All DBs
Position
Un
AA seq 1018 aa AA seqDB search
MSQLRLLPSRLGTQASRLLAPHGVQTFSWCSRSSGPPASFASSRVGGGSSYMEGMYVAWL
ENPQSVHKSWDSFFRKASEEASYSLAQPQGSVVSESRPAASSRTETSKLVEDHLAVQSLI
QAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTVDRLAFYGLREADLEKEFQLPTTTFI
GGSENTLSLREIIRRLELAECPLSPPSACCQLTGLEFMFINDVEQCLWARQRSEAPGVMQ
FSSEEKRTLLAWLVRSVRFEDFLARKWSSEKRFGLEGCEVMIPALKTIIDKSSEMGIENV
ILGMPHRGRLNVLANVIRKDLEQIFCQFDPKLEAADEGSGDVKYHLGMYHERINRVTNRN
ITLSLVANPSHLEAVDPVVQGKTKAEQFYRGDAQGKKVMSILVHGDAAFAGQGVVYETFH
LSDLPSYTTNGTVHVVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMY
VCRVAAAWRNTFNKDVVVDLVCYRRRGHNEMDEPMFTQPLMYKQIHRQAPVLKKYADKLI
AEGTVTLQEFEEEIAKYDRICEEAYGRSKDKKILHIKHWLDSPWPGFFSMDGEPKSMTCP
PTGVPEDTLTHIGEVASSVPLEDFKIHVGLSRILRGRADMIRKRTVDWALAEYMAFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQDIDRRTCVPMNHLWPDQAPYTVCNSSLSEYGV
LGFELGYAMASPHALVLWEAQFGDFHNTAQCIIDQFISTGQAKWVRHNGIVLLLPHGMEG
MGPEHSSARPERFLQMSNDDSDAFPAFTQDFEVRQLYDCNWIVVNCSTPASFFHVLRRQI
LLPFRKPLIIFTPKSLLRHPEAKSSFDQMVSGTSFQRVIPEDGAAARAPEQVRRLIFCTG
KVFYDLVKERSSQGLDERVAITRLEQISPFPFDLIKREAEKYPGAELVWCQEEHKNMGYY
DYVSPRFMTILGRARPTWYVGRDQAAAPATGNRNTHLVSLKKFLDTAFNLQAFEGKTF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagtcagctgaggctgctgccatcccggcttgggacacaggcctcaaggctcctggcc
ccacatggagtccagacgttcagctggtgcagcaggtcgtctgggccgccagcttccttc
gcaagcagcagggttggaggtggttccagttatatggaggggatgtacgtcgcctggttg
gaaaacccccagagtgtccacaagtcctgggacagcttcttccggaaagccagtgaggaa
gcctcttacagcctggctcagccccagggttctgtcgtctctgaaagcaggccggcagca
tccagccggaccgagaccagtaaactggtggaagaccacctggctgtacagtccctgatc
caggcctaccagatccggggccaccatgtggcccagctggaccccttgggcattctggat
gcggacctggactccttcgtaccctcagacttaatcaccaccgttgatagactggccttc
tacggcctgcgggaggctgacctggagaaggagtttcagctgcccacaaccactttcatt
ggaggctccgaaaacaccctttctctacgggagatcataaggcgcctggagctcgcggag
tgccccctgtccccaccgagcgcgtgctgccagctcactggcctggagttcatgttcatc
aacgacgtggagcagtgcctgtgggcccggcagaggtctgaggccccgggcgtgatgcag
ttctccagcgaggagaagcggaccctgctggcctggctagtgcgctccgtgaggtttgaa
gacttcctggccaggaagtggtcttctgagaagcggtttggcctggagggctgtgaggtc
atgattccggccctgaagaccatcatcgacaaatccagcgagatggggattgagaacgtc
atcctggggatgccgcacaggggcaggctgaatgtgctggccaacgttattcgcaaggac
ctggagcagatcttctgccagtttgatcccaagctggaggcggcagacgagggttccgga
gatgtcaagtatcacctcggcatgtaccacgagcggataaatcgagtcacgaacaggaac
atcactctgtcactcgtggccaacccctcccacctggaagcggtggaccccgtggtgcag
ggcaagacgaaggcggagcagttctaccgcggggatgcccagggcaagaaggtcatgtcc
atcctggtccacggggacgctgcctttgctggccagggcgtggtctatgagaccttccac
ctgagcgatctgccctcttacaccaccaacggtaccgtgcatgttgtcgtcaacaaccag
atcggcttcaccacggacccccggatggcccgctcctccccgtaccccaccgacgtggcc
cgcgtggtcaacgcacccatcttccatgtgaacgcggacgacccagaggctgtgatgtac
gtgtgccgcgtggcagccgcgtggaggaacaccttcaataaagatgtcgtggtagacctg
gtctgttaccgccggcgtggccacaacgagatggacgagcccatgttcacgcagcctctc
atgtataagcagatccatagacaggcgcctgtgctgaagaagtacgcagacaagctcata
gctgagggcacagtcaccctgcaggaatttgaggaagaaatcgccaaatatgatcggatc
tgtgaggaggcgtatggcaggtccaaggataaaaaaatcctgcatataaagcactggctg
gactctccctggcctggcttcttcagcatggatggggagcccaagagcatgacgtgccca
cccacaggtgttcccgaggacacgctgacccacattggtgaagtggccagctctgtgccc
ctggaggactttaagatccatgtgggcctctctcgaatcctgcggggccgtgcagacatg
atcaggaagaggacagtggactgggcactggcagagtacatggccttcggctcactgctc
aaggagggcatccatgtgcggctcagcgggcaggacgtggagaggggcacgttcagccac
cggcaccacgttcttcacgatcaggacatcgaccggaggacgtgtgtcccgatgaaccac
ctgtggcctgaccaggccccctacaccgtgtgcaacagctccctctcggagtacggagtc
ctgggtttcgagctgggctacgccatggccagcccccacgccttggtgctctgggaggct
cagtttggcgacttccacaacacggcccagtgcatcatcgaccagttcatcagcacgggt
caggccaagtgggttcgacacaatggcatcgtgctgctgctgccccacggcatggagggc
atgggcccagagcactcttcagccaggcctgagaggttcctgcagatgagcaatgacgac
tcagatgccttccctgcattcacacaggactttgaggtgagacagctctacgactgcaac
tggatcgtggttaactgctccacgccggccagtttcttccacgtgctgcgccggcagatc
ctgctgcccttccgcaagccgctgatcatcttcacacccaaatctctgctgaggcaccca
gaggccaaatccagctttgaccagatggtgtctggaaccagtttccagcgggtgatccct
gaggatggggctgcggcgcgggctcctgagcaggtgcggcggctcatcttctgcacgggc
aaggtgttctacgacctggtgaaggagcggagcagccagggcctggacgagcgcgtggcc
atcacacgcctggagcagatctctccgtttcctttcgacctgatcaagcgagaggcagag
aagtacccaggcgcggagctggtgtggtgtcaggaggagcacaagaacatgggctactat
gactacgtcagcccacgcttcatgaccatcctgggccgggcgcggcctacatggtatgtt
ggccgagaccaagcagctgcaccagccacagggaacaggaacactcacctggtgtctctg
aagaagtttctggatactgccttcaatctccaggcctttgagggcaaaacattttag

DBGET integrated database retrieval system