KEGG   Pantholops hodgsonii (chiru): 102330966Help
Entry
102330966         CDS       T02909                                 

Definition
(RefSeq) glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase SVIP
Motif
Other DBs
NCBI-GeneID: 102330966
NCBI-ProteinID: XP_005966159
LinkDB All DBs
Position
Un
AA seq 452 aa AA seqDB search
MAHTGKNIAQLSILIQSGHLNPRALAEETLDVIRGQDDQAIFVGLTTERAVAEAEAASKR
IREGRSRGLLDGIPVAWKDLFDLEGMATTAGSKVLADATVAARDADVVSALKQAGMVSVG
RTNMSEFAFSGLGINPHYGTPRNPAARDGHRLPGGSSSGAGVAVAAGLVPVAIGTDTGGS
VRIPAAFNGVVGYKASRDRYSMRGVYPLAKSLDSLGPLSRTVQDAAWVDAAMRGKATADV
ARASLSGLSLVVPETVFFDGIEDGVAAAFEQAVERLVRAGASVRRQAFPIFSELFDLIRE
KGALVTAEAFALHKARLEGADAARMDPRVVARTKLGANISMPDYIAILEARERMTAAFSG
MVGRHELLVSPTLPHVAAKVAPLIDDDDAFFAMNAKTLRNTQIGNFFDLCGVSIPCGTGE
AEMPVGLLLSGLHGTDDHLLGVAMAAEEIVRG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggctcacacgggcaaaaacatcgcgcagctttccatcctcatccagagcggccatctt
aatccgcgcgccctggcggaagagacgctcgacgtgatccgcgggcaggacgatcaggcg
atttttgtcgggttgacgacagagcgcgccgtggcggaggcggaggccgcctcgaaacgc
attcgcgaaggccgctcccgtggtctgctcgacggtattccggttgcctggaaggatctt
ttcgatctcgagggcatggcgaccacggccgggtcgaaggtgcttgcagatgccactgtt
gcggcccgtgacgcggatgtggtgtcggcgctgaagcaggcgggcatggtttccgtcggc
cgcaccaatatgagcgagtttgctttttccggcctcggcatcaatccgcattacggcacg
ccgcgcaaccccgccgcgcgggacggtcaccgtttgcccggcggctcgtcctccggcgcg
ggtgtggccgtggctgccggccttgtgccggtggcgatcggtacggataccggaggatcg
gtgcgcattcccgccgcctttaacggcgtggtgggctacaaggcaagccgcgaccgttat
tcgatgcgcggcgtctatcccctggcgaaaagcctcgattcgctcggaccgctcagccgc
accgtgcaggatgccgcctgggtggatgccgccatgcgcggcaaggccacggctgatgtg
gcgcgcgcatctctttccggcctgtcgctggtggtgccggagacagtgtttttcgatggt
atcgaggatggtgttgctgccgccttcgagcaggcggtggagcggctggtgcgtgccggc
gcttcggtgcggcggcaggcattcccgattttttcggagttgttcgatcttatcagggaa
aagggcgcgctggtaacggcggaagcctttgccctgcataaagcccggctggaaggtgcg
gatgccgcgcgtatggacccgcgcgtcgttgcccgaacgaagcttggtgcgaatatctcc
atgcctgactatatcgctattctcgaggcgcgcgaacgcatgacggcggcgttttccggc
atggtcggcaggcacgagcttctagtctcgccaacattgccgcatgtcgcggcaaaggtc
gcgccgctcatcgatgatgacgatgcctttttcgccatgaatgcgaaaaccctgcgcaac
acccagatcggcaatttcttcgatctctgtggtgtttcgatcccctgcggaacaggcgag
gcagaaatgccggtcggcctgctgctttccggtctgcatgggacggatgatcacctgctg
ggtgtggcgatggctgcggaagagattgttcggggttga

DBGET integrated database retrieval system