KEGG   Pantholops hodgsonii (chiru): 102331518Help
Entry
102331518         CDS       T02909                                 

Gene name
ALK
Definition
(RefSeq) anaplastic lymphoma receptor tyrosine kinase
  KO
K05119  anaplastic lymphoma kinase [EC:2.7.10.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd05200  Pathways in cancer
phd05223  Non-small cell lung cancer
phd05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102331518 (ALK)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    102331518 (ALK)
  09162 Cancer: specific types
   05223 Non-small cell lung cancer
    102331518 (ALK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:phd01001]
    102331518 (ALK)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:phd04090]
    102331518 (ALK)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     102331518 (ALK)
Protein kinases [BR:phd01001]
 Receptor tyrosine kinases (RTK)
  ALK family
   102331518 (ALK)
CD molecules [BR:phd04090]
 Proteins
  102331518 (ALK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase MAM Gly_rich Nup96 PRIMA1 FXa_inhibition
Motif
Other DBs
NCBI-GeneID: 102331518
NCBI-ProteinID: XP_005985851
LinkDB All DBs
Position
Un
AA seq 1119 aa AA seqDB search
WTVLQGRIGRPENPFRVALEYISNGNRSLSAVDFFALKNCSEGSSPGSKMALQSSFTCWN
GTVLQLGQACDFHRDCAQEEDEGQLCRKLPAGFYCDFEDGFCGWTQTSPSPHTPQWQVQT
LKDAQFQDHQGRALLLSITDAPTSENATVTSATFPAPMRNSPCELRMSWLIRGVLQGNVS
LMLVENKTGKEQSRMIWHVATLEGLSLWQWTVLPLLEVADRFWLQIVAWWGQGSRAVVAF
DNISVSLDCYLTISGEDKIPQNTAPKSRNLFERNLNSELKPWVNPSKETPIFDPTVHWLF
TTCGASGPHGPTQAQCNNAYRNSNLSVVVGSEGPLKGIQTWKVPATDTYSISGYGAAGGK
GGKNTMMRSHGVSVLGIFNLEKDDTLYILVGQQGEDACPSANRLIQKVCIGENSVIEEEI
RVNKSVHEWAGGGGGGGGATYVFKMKDGVPVPLIIAAGGGGRAYGAKTDTFHPERLENNS
SVLGLNGNSGAAGGGGGWSDNTSLLWSGKSLLEGATGGHSCPQAMKKWGWETRGGFGGGG
GGCSSGGGGGGYIGGNAASNNDPEMDGEDGVSFINPLGILYTPALKVMEGHGEVNIKHYL
NCSHCEVDECHMDPESHKIICFCDHGTVLAEDGVSCIVSPTPDPPPPPPPPLPLSLILSV
VTSALVAALVLAFSGIMIVYRRKHQELQAMQMELQSPEYKLSKLRTSTIMTDYNPNYCFA
GKTSSISDLKEVPRKSITLIRGLGHGAFGEVYEGQVSGMPNDPSPLQVAVKTLPEVCSEQ
DELDFLMEALIISKFNHQNIVRCIGVSLQALPRFILLELMAGGDLKSFLRETRPRPNQPS
SLVMLDLLHVARDIACGCQYLEENHFIHRDIAARNCLLTCPGPGRVAKIGDFGMARDIYR
ASYYRKGGCAMLPVKWMPPEAFMEGIFTSKTDTWSFGVLLWEIFSLGYMPYPSKSNQEVL
EFVTSGGRMDPPKNCPGPVYRIMTQCWQHQPEDRPNFAIILERIEYCTQDPDVINTALPV
EYGPLVEEEEKVPMRPQDPEGIPPLLVSAAQAKREEGREPLLLEPSALTASLRDVPLFRL
RHFPCGTVNYGYQQQGFPAEAAPGPVRYEDPAPKSQPAP
NT seq 3361 nt NT seq  +upstreamnt  +downstreamnt
ttggactgtgctgcagggaagaattgggcgcccagagaacccgttccgagtggccctgga
atatatctcaaatggaaatcgaagcttatctgcagtggacttctttgccctgaagaactg
cagtgaaggatcatccccgggctccaagatggccttgcagagctccttcacttgctggaa
cgggacagtccttcagcttgggcaggcgtgcgacttccaccgggactgtgcccaggaaga
agatgaaggccagctgtgccgtaaactccctgctggtttttactgcgacttcgaggacgg
cttctgcggctggacccaaacctcaccatcaccccacacgccccagtggcaagtccagac
cttaaaggatgcccagttccaagaccaccaaggccgcgcgctattgctcagcatcactga
cgcccccacctctgaaaatgccacagtgaccagcgctacatttcctgcgcccatgaggaa
ctctccatgtgagctccgaatgtcctggctcatccgtggagtcctgcagggaaatgtctc
cttgatgctggtggagaacaaaaccgggaaggaacaaagccgaatgatttggcatgttgc
caccctggaaggcttgagcctgtggcagtggacggtgctgcccctcctcgaggtggccga
caggttctggctacagattgtcgcgtggtggggacaaggatccagagccgtggtggcctt
cgacaatatctccgtcagcctggactgctatctcaccatcagcggggaggacaagattcc
acagaacacagcacccaagtcaagaaatctgtttgagagaaacctgaacagtgagctgaa
accctgggtgaacccatcgaaagaaacccccatctttgaccctacagttcactggctgtt
caccacatgcggggccagtgggccccacggccccacgcaggcccagtgcaacaatgccta
ccggaactccaacctgagcgtggtggtggggagcgagggccccctgaagggcatccagac
ttggaaggtgccagccaccgacacctacagcatctccggctatggggcggctggcggaaa
aggtgggaagaacaccatgatgcggtcccacggcgtgtctgtgctgggcatcttcaacct
ggagaaggatgacacgctgtacatcctggtcgggcagcaaggggaagacgcctgccccag
cgcaaaccgattaatccagaaagtctgcattggagaaaacagcgtgatagaggaggaaat
ccgcgtgaacaaaagcgtgcacgagtgggcaggagggggcggaggagggggaggagccac
ctacgtgttcaagatgaaagatggcgtgccagtgcctctgatcattgcggccggtggtgg
tggcagggcctatggggccaagacagacacgttccacccagagagactggagaataactc
ctcagtcctagggctgaacggcaattctggagctgcaggtggtggaggtggctggagtga
taacacttccttgctctggtctggaaaatctttgctggaaggtgccaccggaggacattc
ctgcccccaggccatgaagaagtgggggtgggagacaagagggggtttcggagggggtgg
aggggggtgctcctccggtggaggaggcggaggatacataggtggcaatgcagcctcaaa
caatgaccccgagatggacggggaggacggggtttccttcatcaatccgctgggcatcct
gtacaccccagctttaaaagtgatggagggccacggggaagtgaacattaagcattacct
aaactgcagccactgcgaggtagatgagtgccacatggaccccgagagccacaaaatcat
ctgcttctgcgaccacgggaccgtgctggctgaggacggcgtctcctgcattgtgtcgcc
caccccagacccccccccccccccccccccccccctgccactctcgctgattctgtccgt
tgtgacctctgccctggtagccgccctcgtcctggctttctctggcatcatgatcgtgta
ccgccggaagcaccaagagctgcaagccatgcagatggagctgcagagcccagagtacaa
gctgagcaagctccgcacctccaccatcatgaccgactacaatcccaactactgttttgc
tggcaagacctcctccatcagtgacctgaaggaggtgccacggaaaagcatcaccctcat
ccggggtctaggccacggtgcgtttggggaggtgtatgaaggtcaggtgtctggaatgcc
caatgaccccagccccctgcaagtggctgtaaagacgctgccggaggtgtgctctgaaca
ggacgaactggatttcctcatggaagccctgatcatcagcaaattcaaccaccagaacat
cgtgcgctgtattggcgtgagtctgcaagccctgccccgatttatcctgcttgagctcat
ggcgggaggagacctcaagtccttcctccgggagacgcgtcctcgtccgaaccagccctc
ctccctggtcatgctggacctcctgcacgtggctcgggacatcgcttgtggctgtcagta
tctagaggagaatcacttcatccaccgggacattgccgccaggaactgcctcttgacctg
cccaggccctggaagagtagccaagattggagacttcggaatggcccgtgacatctacag
agcaagctactaccgaaagggaggctgtgcaatgctgccagtcaagtggatgcccccgga
ggccttcatggaaggaatatttacttctaaaacagacacgtggtccttcggagtgctgct
atgggaaatcttctctcttggatacatgccataccctagcaaaagcaaccaggaagtcct
ggagttcgtcaccagtggaggacggatggacccacctaagaactgcccggggcctgtata
ccggataatgacccagtgctggcaacatcagcctgaagacaggcccaactttgccataat
tttggagaggattgaatactgcactcaggacccagatgtgatcaacaccgctttgccggt
tgaatacgggcccctcgtggaagaggaggagaaggtgcctatgaggccccaggaccccga
gggaatccctcctctcctggtctcggcggcccaggccaagcgagaggagggccgcgagcc
gctgctcctcgagccgtcggcgctgaccgccagcctgcgggacgtgcctctgttcaggct
gcgccacttcccgtgcggcaccgtcaactacggctaccagcagcagggcttccccgcgga
ggccgcccccggcccggtccgctacgaggaccccgcgcccaagagccagcctgcgccctg
a

DBGET integrated database retrieval system