KEGG   Pantholops hodgsonii (chiru): 102332015Help
Entry
102332015         CDS       T02909                                 

Gene name
SDHA
Definition
(RefSeq) succinate dehydrogenase complex flavoprotein subunit A
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00020  Citrate cycle (TCA cycle)
phd00190  Oxidative phosphorylation
phd01100  Metabolic pathways
phd01200  Carbon metabolism
phd04714  Thermogenesis
phd04932  Non-alcoholic fatty liver disease (NAFLD)
phd05010  Alzheimer disease
phd05012  Parkinson disease
phd05016  Huntington disease
Module
phd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
phd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
phd_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    102332015 (SDHA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102332015 (SDHA)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    102332015 (SDHA)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05010 Alzheimer disease
    102332015 (SDHA)
   05012 Parkinson disease
    102332015 (SDHA)
   05016 Huntington disease
    102332015 (SDHA)
  09166 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102332015 (SDHA)
Enzymes [BR:phd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     102332015 (SDHA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 102332015
NCBI-ProteinID: XP_005985311
LinkDB All DBs
Position
Un
AA seq 728 aa AA seqDB search
MEGLPRGGLLCSLTAPSSLSPPPAVSHRPHVQGGGQCGEGWVDPGEALGRLQTCRLGSTG
WRLRRSGVPGSGSVKTRSPPPVFQKRPAAWQTGARDFHFTVDGNKRSSAKVSDAISAQYP
VVDHEFDAVVVGAGGAGLRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGSMEE
DDWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVVELENYGMPFSRTEDGKIYQRAFGGQ
SLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEHFALDLLMESGECCGVIA
LCIEDGSIHRIRARNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFH
PTGIYGAGCLITEGCRGEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTLEIREGRG
CGPEKDHVYLQLHHLPPEQLAVRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTN
YKGQVLKHVNGQDQVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACALSIAESCR
PGDKVPSIKPNAGEESVMNLDKLRFANGSIRTSELRLNMQKSMQSHAAVFRVGSVLQEGC
EKVSSLYRDLQHLKTFDRGMVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHARED
FKERVDEYDYAKPVQGQQKRPFEQHWRKHTLSYVDVKTGEVTLEYRPVIDRTLNETDCAT
VPPAIRSY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggagggcctgccccggggcggcctgctctgcagcctcactgccccctcctcactgtca
ccgcctcctgcagtgagccacaggccccacgtgcagggtgggggccagtgtggagagggc
tgggtggacccgggagaagcacttggtcgtctgcagacctgccgcttaggcagcacaggc
tggcggcttaggagatcgggagtccccggctccggctccgtgaagacgcgcagccctccc
cctgtgtttcagaagcggccggcagcatggcagacaggagcccgcgactttcacttcacc
gttgacggcaacaagaggtcgtccgctaaagtttcagatgcgatctctgcacagtaccca
gtcgtggaccatgagtttgatgccgtggtggtcggtgcagggggagcaggcctgcgggcc
gcgttcggcctctccgaagcaggtttcaacacggcctgtgtcacgaagctcttccccacc
aggtcccatactgtcgcggcccagggagggatcaatgccgccttggggagcatggaggag
gacgactggcggtggcacttctacgacaccgtgaagggctccgactggctgggggaccag
gacgccatccactacatgacggagcaggcccccgcctctgtggtggagctggagaattac
ggcatgccctttagcagaactgaagatgggaagatctaccagcgtgcctttggcggacag
agcctcaagttcgggaagggcgggcaggcccaccgctgctgctgcgtggctgaccgcacg
ggccactcgctcctgcacacgttgtatggaaggtctctgcgctatgacaccagctacttt
gtggagcacttcgccctggacctcctgatggagagcggggagtgctgcggcgtgatcgcc
ctgtgcatagaagacgggtccatccaccgcatcagggccaggaacaccgtcatcgccacc
ggaggctacgggcgcacctacttcagctgcacgtcggcccacaccagcaccggggacggc
accgccatggtgaccagggctggcctgccctgccaggacctggagttcgtgcagttccac
cccacaggtatatatggcgctggctgtctcatcacagagggctgtcgtggagaggggggc
atcctcatcaacagccagggtgagaggttcatggagcgctatgcccccgtcgctaaggac
ctggcatctagggacgtcgtgtcccggtccatgaccctggaaatccgcgagggaagaggc
tgtgggcccgagaaggaccacgtgtacctgcagctgcaccacctgccgccggagcagctg
gctgtgcgcctgcctggcatctcagagacggccatgatctttgcgggcgtggacgtcacc
aaggagcccatccccgtgcttcccaccgtgcactacaacatgggtggcatccccaccaac
tacaaggggcaggttctgaagcacgtgaatggccaggaccaggttgtgcccggcctgtat
gcatgcggggaggctgcctgcgcctcggtgcatggcgccaaccgtctgggtgcaaactcg
ctcctggacctggtggtctttggccgggcgtgcgccctgagcatcgcagagtcctgcaga
cctggagataaagttccctcgattaaaccaaatgctggggaggaatctgtcatgaatctt
gacaaattgagatttgccaatggaagcataagaacatcggaattgcgactcaacatgcag
aagtcgatgcagagccatgccgcggtgttccgtgtgggcagtgtgctgcaggaaggctgt
gagaaggtcagcagcctctacagagacctgcagcatctgaagacgttcgacaggggaatg
gtctggaacactgacctggtggagaccctggagctgcagaacctgatgctttgtgctctg
cagaccatctatggagcggaggcccggaaggagtcgcgtggcgcccatgccagggaggac
ttcaaggagagggttgacgagtacgattacgccaagcccgtccaggggcagcagaagagg
ccgtttgagcaacactggaggaagcacacgctctcctacgtcgacgtcaagactggggag
gtcaccctggaatacagacctgtaatcgacaggactttgaacgagaccgactgtgccact
gtccccccagccatccgctcctactga

DBGET integrated database retrieval system