KEGG   Pantholops hodgsonii (chiru): 102332125Help
Entry
102332125         CDS       T02909                                 

Gene name
GYS2
Definition
(RefSeq) glycogen synthase 2
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00500  Starch and sucrose metabolism
phd01100  Metabolic pathways
phd04151  PI3K-Akt signaling pathway
phd04152  AMPK signaling pathway
phd04910  Insulin signaling pathway
phd04922  Glucagon signaling pathway
phd04931  Insulin resistance
Module
phd_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102332125 (GYS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    102332125 (GYS2)
   04152 AMPK signaling pathway
    102332125 (GYS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    102332125 (GYS2)
   04922 Glucagon signaling pathway
    102332125 (GYS2)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    102332125 (GYS2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:phd01003]
    102332125 (GYS2)
Enzymes [BR:phd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     102332125 (GYS2)
Glycosyltransferases [BR:phd01003]
 Polysaccharide
  Storage polysaccharide
   102332125 (GYS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_trans_4_4 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 102332125
NCBI-ProteinID: XP_005983020
LinkDB All DBs
Position
Un
AA seq 702 aa AA seqDB search
MLRGRSLSVTSLGGLPRWEAGLPVENLLLFEVSWEVTNKVGGIYTVIQTKAKTTADEWGD
NYFLIGPYFEHNMKTQVEQCEPVNDAVRRAMDAMNKHGCQVRFGRWLIEGSPYVVLFDIG
YSAWNLDKWKGDLWEACNVGIPYHDQEANDMLIFGSLTAWFLKEVTDHADGRHVIVQFHE
WQAGIGLILSRARKLPIATVFTTHATLLGRYLCAANIDFYNHLDKFNIDKEAGERQIYHR
YCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHAMYK
ARIQEFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFSLRMHKSDVT
VVVFFIMPAKTNNFNVETLKGQAVRKQLWDTAHSVKEKFGKKLYDALLRGEIPDMNNILD
RDDRTIMKRAIFSTQRQSLPPVTTHNMIDDSTDPILSTIRRIGLFNSRTDRVKLILHPEF
LSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQEH
VADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRYL
GRYYQHARLLTLSRAFPEKFHMEPTSPPTTEGFKYPRPPSVPPSPSGSQASSPQSSDAED
DDEDERYDEEEEAERDRLNIKSPFSLSHVPRGKXKQHGEYKN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgaggtcggtcgctatctgtgacatcgctaggtgggctgcctcggtgggaagcc
ggacttcctgtggagaatttactgctctttgaagtctcttgggaagtgaccaataaagtc
ggtggcatctataccgtgattcagacaaaggccaaaacaacagcagatgaatggggagac
aactattttctgattggtccatattttgagcataatatgaagactcaggtggaacagtgt
gaacctgtgaatgatgctgttagaagagccatggacgcgatgaacaaacacggctgccag
gtgcgctttggaagatggctgatagaagggagtccttacgtggttctctttgacattggc
tattcggcttggaacctggacaagtggaaaggagacctctgggaagcatgcaacgttggc
attccttatcatgaccaggaagccaatgatatgctgatctttgggtcattaactgcctgg
ttcttgaaagaggtgacggaccatgctgatgggaggcacgtcattgtccagttccatgaa
tggcaagccgggattggactgatcctttctcgagctcggaaactgcccattgctacagtc
tttaccacccacgccaccctgcttgggcggtatctctgtgcagctaacatcgatttctac
aaccaccttgataagtttaacatagacaaagaggctggggaaaggcagatttaccaccgg
tactgcatggagcgtgcttccgtccattgtgctcacgttttcaccacggtttctgaaatt
acagcaatcgaggcagaacacatgctgaagagaaaacctgatgtagttactccaaatggc
ttgaacgttaagaaattttcagctgtacatgagtttcaaaatctccatgctatgtacaag
gccaggatccaagagtttgttcgaggtcatttctatggtcatctggactttgatcttgaa
aaaacattgttcctcttcattgcggggaggtatgagttttcaaacaaaggagctgacatc
ttcttagaatccttatccaggttaaacttctccttgagaatgcataaaagtgacgtcacc
gtggtggtgtttttcattatgcctgccaagacaaataatttcaatgtggaaaccctgaaa
ggccaggcagtgcgcaaacagctatgggacactgcacattctgtgaaggaaaagtttgga
aagaaactgtatgatgcattattaagaggagaaattcctgacatgaacaatattttggat
cgagatgatcggacaattatgaaaagagctatcttttcaactcagcggcagtctttgcca
ccagtgaccactcacaacatgattgatgattccaccgatcccatcctcagcaccattaga
cgtattgggctcttcaatagccgcacagacagagtcaagttgattttgcacccagagttc
ctgtcctccaccagccccttgctacccatggattatgaagagtttgtccgaggttgtcat
cttggagtatttccatcatactatgaaccctggggttatactccagctgaatgcactgtg
atgggcatccccagtgtgaccaccaatctctctggctttggctgtttcatgcaggagcat
gtggctgaccccactgcatatggaatttacatcgttgacaggcggttccgctcacctgat
gattcttgcaatcaactgactcagtttctctacggattttgcaaacagtcacgccgccag
aggattattcaaaggaatcgaaccgagaggctctcagatcttctggactggagatactta
ggcagatattaccagcatgccaggctcctgacattaagtagagcctttccagaaaaattc
cacatggaacccacatcaccaccaacgacagaagggtttaagtatcccaggccgccctcg
gtaccaccttctccatcgggatctcaggcctccagtcctcagagcagcgatgcagaggat
gacgatgaggatgagagatacgacgaggaggaagaggccgaaagggatcggttaaatatc
aagtcgccgttttctctgagtcacgttcctcgcgggaaatagaagcagcacggagaatac
aagaattga

DBGET integrated database retrieval system