KEGG   Pantholops hodgsonii (chiru): 102332215Help
Entry
102332215         CDS       T02909                                 

Gene name
AMY2B
Definition
(RefSeq) amylase, alpha 2B (pancreatic)
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00500  Starch and sucrose metabolism
phd01100  Metabolic pathways
phd04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    102332215 (AMY2B)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    102332215 (AMY2B)
Enzymes [BR:phd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     102332215 (AMY2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amylase_C Alpha-amylase
Motif
Other DBs
NCBI-GeneID: 102332215
NCBI-ProteinID: XP_005978819
LinkDB All DBs
Position
Un
AA seq 511 aa AA seqDB search
MKFFLLLSAIGFCWAQYDPHTKTGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQISPP
NENAVITDPSRPGKIRYQPVSYKLCTRSGNESEFKDMVTRCNNVGVRIYVDAVINHMTGS
GVSAGKSSTCGSYFNPGTRDFPAVPYSGWDFNDGKCKTGNGEIKSYNVAYQVRDCRLVGL
LDLALEKDYVRSTIAEYLNRLIDIGVAGFRIDASKHMWPGDIKAVLDKLHNLNTSWFPEG
SRPFIYQEVIDLGGETITSSEYFGNGRVTEFKYGAKLGTVLRKWSGEKMAYLKNWGEGWG
FMPSYRALVFVDNHDSQRGHGAGGASILTFWDARLYKMGVGFMLAHPYGFTRVMSSYHWP
RYFENGKDVNDWIGPPNNNGVIKEVIINPDTTCGNGWVCEHRWRQIRNMVIFRNVVNGQP
FTNWWDNGSNQVAFGRGNKGFVVFNNDDWALSATLQTGLPSGTYCDVISGDKIGDNCTGI
EINVSCDGNAYFSISNSAEDPFIAIHTKSKL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaagttctttctgttgctttcagcgattgggttctgctgggctcagtatgacccacac
accaaaactggacggacatctattgtccatctgtttgagtggcgctgggttgatattgct
cttgaatgtgagcgatacttagcccccaaaggatttggaggggttcagatctccccaccc
aatgaaaatgctgtgattactgacccttcaagaccgggaaagataagatatcaaccagtt
agctacaagttatgtacaagatcaggaaatgaaagtgaattcaaagacatggtgactaga
tgtaacaatgttggtgtccgcatttatgtggatgctgtaattaatcatatgactggaagt
ggtgtgagtgcaggaaagagcagtacttgtggaagttacttcaaccctggaactagggat
ttcccagcagtcccatactctggatgggattttaatgatggaaaatgtaaaactggaaat
ggagaaattaagagctataatgttgcttatcaggtcagagattgtcgtctggttggtctt
cttgaccttgcattggagaaagattatgtgcgctccacaattgctgaatatctaaaccga
ctcattgacattggtgtagcagggttccgaattgatgcttctaagcacatgtggcctgga
gacataaaggcagttttggataaactgcataatctaaacacaagctggttccctgaagga
agtagacctttcatttaccaagaggtaattgatctgggtggtgagacaattacaagcagt
gagtactttggaaatggccgtgtgacagaatttaagtatggtgcaaaactaggcacagtt
ctacgcaagtggagtggagagaagatggcttacttaaagaactggggagaaggctggggt
ttcatgccttcttacagggcacttgtctttgttgataaccatgacagtcagcgagggcat
ggagctgggggagcatctattcttacattctgggatgctagactgtacaaaatgggagtt
ggatttatgcttgctcatccctatggatttacacgagtaatgtcaagctaccattggcca
agatattttgagaatggaaaagatgttaatgattggattgggccaccaaataataatgga
gtaattaaagaagttattattaatccagatactacttgtggcaatggctgggtctgtgaa
catcgatggcgtcaaataaggaacatggttatattccgtaatgtggttaatggacagcct
tttacaaactggtgggataatggtagtaaccaagtagcttttggaagaggaaacaaagga
ttcgttgttttcaacaatgatgactgggcattatctgcaactttgcaaactggtcttcct
tctggtacatattgtgatgttatttctggagataaaattggtgacaattgtacaggaatt
gaaatcaatgtttcttgtgatggtaatgcttatttttcaattagtaactctgctgaggat
ccatttattgcaattcataccaaatctaaattataa

DBGET integrated database retrieval system