KEGG   Pantholops hodgsonii (chiru): 102332566Help
Entry
102332566         CDS       T02909                                 

Gene name
NOTCH1
Definition
(RefSeq) notch 1
  KO
K02599  Notch 1
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd01522  Endocrine resistance
phd04330  Notch signaling pathway
phd04658  Th1 and Th2 cell differentiation
phd04919  Thyroid hormone signaling pathway
phd05020  Prion diseases
phd05165  Human papillomavirus infection
phd05200  Pathways in cancer
phd05206  MicroRNAs in cancer
phd05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102332566 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    102332566 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    102332566 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102332566 (NOTCH1)
   05206 MicroRNAs in cancer
    102332566 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    102332566 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    102332566 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    102332566 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    102332566 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Ank_2 Ank DUF3454 Notch NOD Ank_5 NODP EGF_2 Ank_4 Ank_3 EGF_3
Motif
Other DBs
NCBI-GeneID: 102332566
NCBI-ProteinID: XP_005959648
LinkDB All DBs
Position
Un
AA seq 2468 aa AA seqDB search
MGSAGTRSGAPAGPLPAQTDLGDRGSLHGEATVTRTKLPSCPHAAGQQPLQLSHFPTSGG
AECGQHRPPCATPWKNLFEQQDNPGAWIGAPAQPRSPVKPGVDSAPGGAGWADLSSCASP
GLRCSQPGETCLNGGKCEVFPNGTEACICSGAFAGQQCQAPNPCLSAPCKNGGTCHTTER
EGLVDYVCSCRLGFSGPLCLTPRDHACLASPCLNGDGPPSTWPWTVLDWARLWGGGQCLP
FEASYICRCPPGFHGPTCRQDINECSQSPGLCHHGGTCLNEVGSYRCVCRPTHTGPHCEL
PYVPCRPSPCQNGCASRPTGDTTHECACLPGFTGQNCEENIDDCPGNSCKNGGACVDGVN
TYNCRCPPEWTGQYCTEDVDECQLMPNACQNGGACHDRVASFYCECPHGRTGLLCHLNDA
CISNPCNEGANCDTNPVNGKAICTCPSGYTGPACSQDVDECSLGANPCEHAGKCINTLGS
FECQCLQGYTGPRCEIDVNECVSNPCQNDATCLDQIGEFQCICMPGYEGLHCEVNTDECA
SSPCLQNGRCLDKVNEFVCECATGFTGHLCQYDVDECASTPCKNGAKCLDGPNTYTCVCT
EGYTGPHCEVDIDECDPDPCHYGSCKDGVATFSCLCQPGYTGHHCETNINECHSQPCRHG
GSCQDRDNSYLCFCLKGTTGPNCEINLDDCASNPCDSGTCLDKIDGYECACEPGYTGSMC
NINIDECADSPCHNGGTCEDGINGFTCRCPEGYHDPTCLSEVNECSSNPCVHGACRDSLN
GYKCDCDPGWSGANCDVNNDECESNPCVNGGTCKDMTSGYVCACREGFSGPNCQTNINEC
ASNPCLNQGTCIDDVAGYKCNCLLPYTGATCEVVLAPCAPGPCRNGGECRESEDYESHCX
ACWPLWPGDRELVGXRRPQAHNAACWTGLPAEHPGGSARSPEFWSPWQRGGAQLSGLPSC
PLADPCHNGGSCTDGINTAFCDCLPGFQGAFCEEDINECASNPCRNGANCTDCVDGYTCT
CPTGFSGIHCENNTPDCTESSCFNGGTCVDGINSFTCLCPPGFTGSYCQHDVNECDSRPC
LHGGTCQDSYGAYKCSCPQGYTGLNCQTLVRWCDSSPCKNGGRCWQTNALYRCECHSGWT
GLYCDVPSVSCEVAARQQGINVTHLCRNGGLCMNAGNTHHCHCQAGYTGSYCEEQVDECS
PSPCQNGATCTDYPGGYSCECVPGYHGVNCSEEVNECLSQPCRHGGTCIDLTNTYKCSCP
RGTQGVHCEINVDDCNPPIDPVSRGPKCFNNGTCVDQVGGYSCTCPPGFVGERCEGDVNE
CLSNPCDARGTQNCVQRVNAFHXXXXHAGGCRPGQGGRRCESVINGCKDRPCKNGGSCAV
ASNTARGFICKCPAGFEGATCENDARSCGSLRCLNGGTCIAGPRSPACLCLGPFTGPECQ
FPASSPCVGGNPCYNQGICEXXXXFTGCRCPAKFNGLLCHILDYSFGGGVGLDIPPPQIE
ETCELPGCREEAGNKVCSLQCNNHACGWDGGDCSLNFDDPWQNCTQALQCWKYFSNGRCD
SHQCNSAGCLFDGFDCQRAEGQCNPLYDQYCKDHFRDGHCDQGCNSAECEWDGLDCAEHV
PEGRAAGTLVLVVLMPPEQLRNRSLHFLRELSRLLHTNVVFKRDASGQQMIFPYYGREEE
LRKHPVKRSVDGGAPLLPGGAGRRQRRELDPMDIRGSIVYLEIDNRQCVQSSYQCFQSAT
DVAAFLGALASLGSLNIPYKIEAVQNNQNEWGDEGLEAKKFRFEEPVVLPDLDGQTDHRQ
WTQQHLDAADLRVPAMAPTPPQGEADADCMDVNVRGPDGFTPLMIASCSGGGLETGNSEE
EEDAPAVISDFIYQGASLHNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGR
TPLHAAVSADAQGVFQILIRNRATDLDARMHDGTTPLILAARLAVEGMLEDLINSHADVN
AVDDLGKSALHWAAAVNNVEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLD
HFANRDITDHMDRLPRDIAQERMHHDIVRLLDEYSLVRSPPLHGATLGGAPTLSPPLCSP
NGYLGNLKPPMQGKKTRKPSTKGLACGGKEPKDLKARRKKSQDGKGCLLDSGSVLSPVDS
LESPHGYLSDVASPPLLPSPFQPSPSVPLNHLPGMPEAHLGVSHLSVAAKPEMAVFPVGG
AAGLNGQCEWLSRLQNGLVPNQYNPLRGGVTPGTLSTQAGGLTXXXXHGTVGPLHAPALS
QVMSYQALPNTRLASQPHLVQTQQLQPQQNLQMQPPSMPPQPNLQPPQPHLGVSSAASGH
LGRSFLGGELSQADMQPLGPGNLAAHTVLPQDGQVLPTSLPSTLAPPMTTAQFLTPPSQH
SYSSSPVDNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSNISDWSEGISSPPTSVPSQI
AHVPEAFK
NT seq 7407 nt NT seq  +upstreamnt  +downstreamnt
atggggtctgccggcacccgcagtggggccccggctggcccactcccagcacagacagac
ctgggtgaccgcggatccctgcacggggaggccaccgtcacccgcaccaagctgcccagc
tgcccccacgctgcggggcagcagcccttgcagctgtcgcattttcccacgagcggggga
gctgagtgtggccagcaccgccccccctgcgccaccccctggaagaacttgtttgaacag
caagacaatcctggtgcttggataggggccccagcccagccaaggtccccggtgaagccg
ggggtagacagtgcccctgggggtgctggctgggctgacctctcctcttgcgcctcccca
ggcctgcgctgctcccagcccggtgagacctgcttgaacggcgggaagtgtgaagtgttc
cccaatggcaccgaggcctgcatatgcagcggggccttcgcaggccagcaatgccaggcc
cccaacccctgcctcagcgccccctgcaagaacggcgggacgtgccacacgacggagcga
gaaggcctggtggactacgtctgcagttgccgcctgggcttctcggggccgctgtgcctg
acgccccgcgaccacgcctgcctcgccagcccctgcctcaacggcgacggccccccgtcc
acgtggccgtggacggtcctggactgggctcggctgtggggcggtggccagtgcctgccc
tttgaggcgtcgtatatctgccgctgcccgcccggcttccacggccccacgtgcaggcag
gacatcaacgagtgcagccagagccccgggctctgccaccacggcggcacctgcctcaac
gaggtcggctcctaccgctgcgtctgccgccccacccacaccggcccccactgcgagctg
ccctacgtgccctgcaggccctccccctgccagaatggctgcgcctcccgccccacaggg
gacaccacccacgagtgcgcctgcctgccaggcttcaccggccagaactgcgaggaaaac
attgacgactgtccagggaacagctgcaagaatggaggcgcctgtgtggacggcgtgaac
acctacaactgccgctgccccccggagtggacaggtcagtactgcacagaggacgtggat
gagtgccagctcatgcccaatgcctgccagaacggcggggcctgccacgaccgcgtggcc
tccttctactgcgagtgtccccatggccgcacgggtctgctgtgccacctgaacgatgcc
tgcatcagcaacccctgcaacgagggcgccaactgtgacaccaaccccgtcaacggcaag
gccatctgcacttgcccctcggggtacacggggccggcctgcagccaggatgtggacgag
tgctcgctgggtgccaacccctgtgagcacgcgggcaagtgcatcaacacgctgggctca
ttcgagtgccagtgtctgcagggctacaccggcccgcgctgtgagatcgacgtcaacgag
tgtgtatcgaacccgtgtcagaacgacgccacctgtctggaccagatcggggagttccag
tgtatctgcatgcctggctacgagggcctgcactgcgaggtgaacacggacgagtgcgcc
agcagcccctgcctgcagaacggccgctgcctggacaaggtcaacgagttcgtgtgcgag
tgcgccacgggcttcaccgggcacttgtgccagtatgacgtggacgagtgtgcgagcaca
ccctgcaagaacggcgctaagtgcctggacgggcccaacacctacacctgcgtgtgcaca
gaaggctacacggggccccactgcgaggtggacatcgacgagtgtgaccccgacccctgc
cactacgggtcctgcaaggacggcgtagccaccttcagctgcctgtgccagccgggctac
acgggccaccactgcgagaccaacatcaacgagtgccacagccagccctgccgccacggg
ggctcctgccaggaccgcgacaactcctacctctgcttctgcctcaaggggaccacagga
cccaactgcgagatcaacctggatgactgcgcgagcaacccctgcgactccggcacgtgt
ctggacaagattgacggctatgagtgtgcgtgtgagccgggctacacagggagcatgtgt
aacatcaacattgacgagtgcgcggacagcccctgccacaacgggggcacctgcgaggac
ggcatcaacggcttcacctgccgctgcccggagggctaccacgaccccacctgcctgtct
gaggtcaacgagtgcagcagcaacccctgcgtccacggggcctgccgcgacagcctcaac
gggtacaagtgtgactgtgaccccgggtggagtggggccaactgcgatgtcaacaacgat
gagtgtgagtcgaacccctgcgtcaacggaggcacctgcaaggacatgaccagcggctac
gtgtgcgcctgccgggagggcttcagtgggcccaactgccagaccaacatcaacgagtgc
gcgtccaacccgtgtctgaaccagggcacgtgtatcgatgacgtggcagggtacaaatgc
aactgcctcttgccctacacaggggccacgtgtgaggtggtgctggccccgtgtgccccc
gggccctgcagaaatggtggtgagtgtcgggagtcagaggactatgagtctcactgttaa
gcctgctggcctttatggcctggggaccgggagctcgtgggatagcgtagaccccaagct
cacaatgcagcctgctggactgggctccctgcggaacaccctgggggcagtgccaggagc
ccggagttttggtcgccctggcagaggggtggtgcccagctctcaggcctgccctcctgt
cccctcgcagacccatgccacaacgggggctcctgcacagacggcatcaacacagccttc
tgcgactgcctgcccggcttccagggcgccttctgcgaggaggacatcaacgagtgtgcc
agcaatccctgccgcaacggcgccaactgcaccgactgcgtggacggctacacctgcacc
tgccccacgggcttcagtggcatccactgcgagaacaacacgcccgactgcacagagagc
tcctgcttcaacggcggtacttgcgtggacggcatcaactccttcacctgcctgtgtcca
cccggcttcaccggcagctactgccagcatgatgtcaacgagtgtgactctcggccttgc
ctgcatggcggcacctgccaggacagctacggtgcctacaagtgcagctgcccgcagggc
tacacgggcctcaactgccagaccctcgtgcgctggtgtgactcgtctccctgcaagaat
ggtggccggtgctggcagaccaacgcgttgtaccgctgtgagtgccacagtggctggact
ggcctctactgtgacgtgcccagcgtctcctgtgaggtggccgcacggcagcaaggcatc
aacgtgacccacttgtgccggaacgggggcctctgcatgaacgcgggcaacacacaccac
tgccactgccaggccggctacacgggcagctactgtgaggagcaggtggacgagtgctca
cccagcccctgccagaacggggccacctgcactgactaccccggtggctactcctgtgag
tgtgtgcccggctaccacggggtgaactgctccgaggaggtgaatgagtgcttgtcccag
ccctgccggcacggaggcacttgcatcgacctcaccaacacctacaagtgctcctgcccc
cgcggcacacagggcgtgcactgcgagatcaacgtggacgactgcaacccccccatcgac
cccgtgtcccggggccccaagtgctttaacaacggcacctgcgtggaccaggtgggcggc
tacagctgcacctgcccgcctggcttcgtgggtgagcgctgtgagggtgatgtcaacgag
tgcctgtccaacccctgcgacgcccgtggcacccagaactgtgtgcagcgcgtcaatgcc
ttccactnnnnnnnnngccacgctggtgggtgccgccctggtcaggggggacgccgctgc
gagtcggtcattaacggctgcaaggacagaccctgcaagaacgggggtagctgtgcggtg
gcctccaacacggcccgcgggttcatctgcaaatgcccagcgggcttcgagggtgccacg
tgtgagaacgacgcccgcagctgcgggagcctgcggtgcctgaacggtggcacgtgcatc
gcgggcccgcgaagccccgcatgcctgtgcctgggccccttcaccggccccgagtgccag
ttcccggccagcagcccctgcgtgggcggcaacccttgctacaaccagggcatctgcgag
nnnnnnnnnnnnttcaccggctgcagatgccccgccaagttcaacgggctcctgtgccac
atcctggactacagcttcgggggcggcgtgggcctcgacatccccccgccgcagatcgag
gagacctgcgagctccccggctgccgcgaggaggccggcaacaaggtctgcagcctgcag
tgcaacaaccacgcgtgcggctgggacggcggcgactgctccctcaactttgacgacccc
tggcagaactgcacgcaggccctgcagtgctggaagtacttcagcaacggccgctgtgac
agccaccagtgcaactcggccggctgcctcttcgacggcttcgactgccagcgcgcagaa
ggccagtgcaaccccctgtacgaccagtactgcaaggaccacttcagggatgggcactgc
gaccagggctgcaacagtgcggagtgcgagtgggacgggctggattgcgcggagcacgtg
cctgaggggcgggcggccggcacgctggtgctggtggtactcatgccacccgagcagctg
cgcaaccgctccctgcacttcctgcgcgagctcagccgcctgctgcacaccaacgtggtc
ttcaagcgcgacgccagcggccagcagatgatcttcccttactacggccgcgaggaggag
ctgcgcaagcaccccgtcaagcgctccgtggatggcggggccccgctgctcccaggcggc
gccggcagacgccagcgcagggagctggaccccatggacatccgtgggtccatcgtctac
ctggagatcgacaaccggcagtgcgtccagtcgtcctatcagtgcttccagagcgccacg
gacgtggctgccttcctgggcgcgctggcctcgctgggcagcctcaacatcccctacaag
atcgaggccgtgcagaacaaccagaatgagtggggcgacgagggcctggaggccaagaag
ttccggtttgaggagcccgtggtcctccctgacctggacggccagacagaccaccggcag
tggacccagcagcacctggacgccgccgacctgcgcgtgcctgccatggcccccacgcct
ccccagggcgaggcggatgccgactgcatggatgtgaacgtccgtgggccggatggcttc
acgcccctcatgatcgcctcctgcagcggagggggcctagagacaggcaacagcgaagag
gaggaagacgcgcccgcggtcatctcggacttcatctaccagggcgccagcctgcacaac
cagacggaccgcaccggcgagaccgccctgcacctggccgcccgctactcgcgctccgac
gcggccaagcgcctgctggaggccagcgcggacgccaacatacaggacaacatgggccgc
accccgctgcacgcggctgtgtctgctgacgcacagggcgtcttccagatcctgatccgg
aaccgagccaccgacctggacgcccgcatgcatgacggcacgaccccactgatcctggcc
gcgcgcctggccgtggagggcatgctggaggacctcatcaactcccacgccgacgtcaac
gccgtggatgacctgggcaagtctgccctgcactgggcagccgcggtgaacaatgtggag
gctgctgtcgtgctgctgaagaacggggccaacaaggacatgcagaacaacaaggaggag
acgcccttgttcctggcggcccgggagggcagctacgagaccgccaaggtgctgctggac
catttcgccaaccgggacatcacagaccacatggaccgcctgcctcgcgacatcgcgcag
gagcgcatgcaccacgacatcgtgcggctgctggacgagtacagcctggtccgcagcccc
ccgctgcatggcgccaccctgggtggcgcacccaccctgtcgcccccgctctgctcgccc
aacggctacctgggcaacctcaagccccccatgcagggcaagaagacccgcaagcccagc
accaagggcctggcctgcggcggcaaggagcccaaggacctcaaggctcggaggaagaag
tcccaagatggcaagggctgcctgctggacagcgggagtgtgctgtcacccgtggactcc
ctcgagtccccccacggctacctttcagacgtggcctccccgcccctcctgccctcccct
ttccagccgtctccgtccgtgcccctcaaccacctgcccgggatgcccgaggcccacctg
ggcgtcagccacctgagcgtggcagccaagcccgagatggcggttttccccgtgggtgga
gccgcgggcttgaatggccagtgcgagtggctgtcccggctgcagaatggcctggtgccc
aaccagtacaacccgctgcgagggggcgtgacgccgggcaccctgagcacacaggctggc
gggcttacatnnnnnnnnnngcatggcacggtgggcccgctgcacgcccccgccctgtcc
caggtgatgagctaccaggccctgcccaacacgcggctggcctcccagcctcacctggtg
cagacgcagcagctgcagccacagcagaacttacagatgcagccgccgagcatgccgcca
cagccaaacctgcagccgccgcagccgcaccttggcgtgagctcggccgccagcggccac
ctgggccggagcttcctgggaggggagctgagccaggcggacatgcagccgctggggccc
ggcaacctggcggcacacaccgtccttccgcaggacggccaggtcctgcccacgtcgctg
ccgtccacactggccccgcccatgaccaccgcccagttcctgacgcccccctcccagcac
agctactcgtcctccccggtggacaacacccccagccaccagctacaggtgcccgagcac
cccttcctcaccccgtcccccgagtcccccgaccagtggtccagctcctcgccacattcc
aacatctccgattggtctgagggcatctccagcccgcccaccagcgtgccgtcccagatc
gcccacgtcccggaggcattcaagtaa

DBGET integrated database retrieval system