KEGG   Pantholops hodgsonii (chiru): 102333030Help
Entry
102333030         CDS       T02909                                 

Definition
(RefSeq) glycerol-3-phosphate dehydrogenase, mitochondrial-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored Pyr_redox_2 NAD_binding_8 STPPase_N
Motif
Other DBs
NCBI-GeneID: 102333030
NCBI-ProteinID: XP_005976564
LinkDB All DBs
Position
Un
AA seq 464 aa AA seqDB search
MSDEAIHDIFVIGGGINGCGIARDAVGRGYSVALAEMNDFASGTSSAATKLIHGGLRYLE
HYEFRLVREALMEREILWAMAPHIIWPMRFVLPFQKGGVRPAWLVRLGLFLYDHLGGRKL
LPATHRGALILNRTQVVSARREGAFWRVETKSATGEVSTYRARMLVNAAGPWVDRVLSST
FGKNNVHNVRLVQGSHIIVRKKFSDPRAYFFQNPDGRIIFAIPYEQDFTLIGTTDRDYTG
DPRAVKISDEEISYLCGAASEYFAEPVKPADIVWTYSGVRPLFDDGASKAQEATRDYVLK
TEGAEGEAPLLNIFGGKLTTYRRLAEHALEKIGDALGEKGVPWTAGSHLPGGNFGAEAYA
SEVSALRSRYPFLDERHAGRLVRCYGTDAVTMIGSATDTAALGRHFGGTLYEAEVRWLMA
REWALTAEDILWRRTKQGLVFTSEEVRGLEDFIEDIAGGRLKAI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacgaggcaatccacgatattttcgtgatcggcggcggtatcaatggctgcggc
atcgcgcgtgacgccgttggcaggggttactccgtcgcacttgcggaaatgaacgatttt
gcttccggcacgtcctccgccgccaccaagctcatccatggcggtttgcgttatctcgaa
cattatgaatttcgtctggtgcgcgaagccttgatggagcgcgagatcctgtgggccatg
gcgcctcacatcatctggcccatgcgcttcgttctgccattccagaagggcggggtgcgt
ccggcctggctcgttcgcctcggacttttcctttacgaccatctcggcggccgcaagctg
ctgcccgccacacatcgcggcgccctgatcctcaaccgcacgcaggttgtttccgcgcgc
cgggaaggcgcgttctggcgggtggagacgaaaagcgcgacgggtgaggtctcaacctat
cgggcgcgcatgctggtcaacgctgccggtccctgggtcgacagggttctgtcttcgact
ttcggtaagaacaatgtccacaatgtgcgcctcgtgcagggcagccatatcattgtccgc
aagaaattttccgatccgcgcgcctatttcttccagaacccggatggacgcatcattttc
gccatcccctatgaacaggattttacgctgatcggcacgacggatcgcgactataccggc
gacccccgggcggttaagatcagcgatgaggaaatcagctatctctgtggtgcggcgagc
gaatatttcgctgaaccggtgaagcctgccgatatcgtctggacctattccggtgtgcgg
ccgctctttgatgacggtgcttcgaaggcgcaggaagcgacccgcgattatgtactgaaa
accgaaggggcggagggcgaggcgccgcttctcaatattttcggtggcaagctcaccacc
tatcggcggcttgccgaacatgctcttgaaaagatcggcgatgcactgggtgaaaagggt
gtgccatggaccgcgggttcgcatctgccgggtggaaatttcggtgccgaggcctatgcc
tcggaggtttctgccctgcggtcgcgttatcccttccttgatgaacgccatgccgggcgg
cttgtacgttgttacggaacggatgcggtgaccatgatcggctccgccaccgatacggcg
gcgctgggtcggcatttcggcggcacgctttatgaagccgaggtccgctggctgatggcg
cgggaatgggcgctgacggcggaggatattctgtggcgccgcaccaagcaggggctggtc
ttcacctctgaagaggtgcgcggactggaggattttatcgaagacattgcaggtggacgc
ttgaaggcaatctga

DBGET integrated database retrieval system