KEGG   Pantholops hodgsonii (chiru): 102334339Help
Entry
102334339         CDS       T02909                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd00010  Glycolysis / Gluconeogenesis
phd00030  Pentose phosphate pathway
phd00051  Fructose and mannose metabolism
phd00052  Galactose metabolism
phd01100  Metabolic pathways
phd01200  Carbon metabolism
phd01230  Biosynthesis of amino acids
phd03018  RNA degradation
phd04152  AMPK signaling pathway
phd05230  Central carbon metabolism in cancer
Module
phd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:phd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    102334339 (PFKP)
   00030 Pentose phosphate pathway
    102334339 (PFKP)
   00051 Fructose and mannose metabolism
    102334339 (PFKP)
   00052 Galactose metabolism
    102334339 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    102334339 (PFKP)
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    102334339 (PFKP)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    102334339 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:phd01009]
    102334339 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:phd03019]
    102334339 (PFKP)
Enzymes [BR:phd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     102334339 (PFKP)
Protein phosphatases and associated proteins [BR:phd01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     102334339 (PFKP)
Messenger RNA biogenesis [BR:phd03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     102334339 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 102334339
NCBI-ProteinID: XP_005979205
LinkDB All DBs
Position
Un
AA seq 803 aa AA seqDB search
MNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARC
QDFRTREGRLKAACNLVQLGITSLCVIGGDGSLTGAHIFQTEWSGLLEELARDGKISAEQ
VQKHGHLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMG
RHCGYLALVSALACGADWVFLPESPPEEGWQENMCVKLSENRARKKRLNIIIVAEGAIDT
QNKPITSEQIKELVVTQLGYDTRVTILGHVQRGGTPSAFDRILASRMGVEAVVALLQATP
ETPACVVSLSGNQAVRLPLMECVQMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLA
IKLPDSEIPKSNCNVGVVNVGAPAAGMNAAVRAAVRVGISEGHKMFAVYDGFEGFAKGQI
KEIGWGDVGGWTGQGGSILGTKRTLPGKSLEDIAAQMRTHGISALLIIGGFEAYLGLLEL
LAARQKHEEFCVPMVMVPATVSNNVPGSDFSIGADTALNTITDAFQSLLELSKNHDSHPE
FCIPVCMVPATISNNVPGTDLSIGCDTSLNVIVETCDRIKQSASGTKRRVFIIETMGGFC
GYLANMGGLAAGADAAYIFEEPFDIRDLQSNVEHLTEKMKTSIQRGLVLRNESCSENYTT
DFIYQLYSEEGKGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISSKLRESAGK
GKKFLSEDSVCVLGISKRTLLFQPVAELKKETDFEHRIPKEQWWLKLRPLMKILAKYKVS
FEVSDASQLEPVQPRGPEEPAAI
NT seq 2412 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctgctgtccgggccgtcgtgcgcatggggatatacgtgggcgccaaggtgtac
ttcatctatgagggctaccagggcatggtggacggcggcagcaacattgtggaagccgac
tgggagagcgtctccagcatcctgcaagtgggagggaccatcatcggcagtgcccgctgc
caggacttccgtactcgggaaggccgcctgaaggccgcatgtaacttggttcagctgggc
atcaccagcctgtgtgtgatcggcggggacggcagcctcaccggggcccatatcttccag
acggagtggagcgggctgctggaagagctggcccgtgacggcaagatcagcgcggagcag
gtgcagaaacacgggcacctcaatgtggtgggaatggtgggctccatcgacaacgacttc
tgcggcaccgacatgaccatcggcacagactcggccctacaccgcatcatcgaggtggtg
gacgccatcatgacaactgcccagagccaccagcggaccttcgtcctggaggtgatgggg
agacattgcgggtacctggccctggtgagcgctctggcctgcggggccgactgggtgttc
cttcccgagtccccaccagaggaaggctggcaggaaaacatgtgcgtcaagctctcagag
aaccgtgcccggaagaaaaggttgaacatcatcattgtggccgaaggggccatcgacacc
cagaacaagcccatcacctcggagcagatcaaggagctcgtggtcacgcagctgggctac
gacacgcgagtgaccatccttggacacgtgcagagaggcgggacgccgtcagcttttgac
aggattctggccagccgcatgggggtggaggctgtggtcgccctcctgcaggccactccc
gagactccggcctgcgtggtgtcactgagcgggaaccaggcagtgcggctgcccctgatg
gagtgtgtacagatgacccaggaggtacaaaaggcgatggatgagaggagatttaaggat
gccgtgcaactccgaggaaggagcttcgagaacaaccttaacacctacaagaggctggcc
atcaagctgccagactccgaaatcccaaagagcaactgcaatgtgggcgtcgtgaacgtg
ggtgcgcccgcggccggcatgaatgcggccgtgcgcgccgccgtgcgtgtgggcatctct
gaaggacacaagatgtttgctgtgtatgacggcttcgagggcttcgccaaaggccagata
aaggaaatcggctggggggatgttggaggctggacaggccaaggtggctccatccttggg
acaaaacgcaccctccctgggaaatccctggaggacatcgcggcgcagatgcgaacccat
ggcatcagcgcgctcttgattatcggtggattcgaggcctacctggggctgctggagctg
ttggccgcccggcagaagcacgaggagttctgtgtccccatggtcatggtccccgccacc
gtctccaacaacgtgcccggctctgacttcagcattggggcggacaccgccctcaacacc
atcaccgacgctttccagagcttgctggagctgtcgaagaaccacgacagccaccctgag
ttttgcatccccgtttgtatggtgcccgccaccattagcaacaatgtcccaggcacagac
ctgagcataggttgtgacacgagcctgaacgtgattgtggagacgtgcgaccgcatcaag
cagtcggccagcgggaccaagcggcgcgtgttcatcatcgagaccatggggggcttctgc
ggctacctggccaacatggggggactggcggctggtgcagatgctgcctacatcttcgag
gagcctttcgacatccgggacctgcagtccaacgtggagcacctgacggagaagatgaag
accagcatccagagggggctcgtgctcaggaacgagagctgcagcgagaactacaccact
gacttcatctaccagctctactccgaggagggcaagggtgtgttcgactgcaggaagaat
gtactgggccacatgcagcagggtggggcaccttctccgttcgacagaaactttggaacc
aaaatttccgccagagccatgcagtggatcagctcgaagctgagggagtccgcggggaaa
ggaaaaaaatttttaagtgaggactctgtgtgtgtgctgggaatcagcaagagaacactg
ctgttccagcccgtggcggagctgaagaaggagacagacttcgagcaccggatccccaag
gagcagtggtggttgaagctgcggcccctcatgaagatcctggccaagtacaaggtcagc
ttcgaggtgtcagatgccagccagctggagcctgtgcagccccgtggccctgaggagccg
gccgccatctag

DBGET integrated database retrieval system