KEGG   Pantholops hodgsonii (chiru): 102334397Help
Entry
102334397         CDS       T02909                                 

Definition
(RefSeq) (R,R)-butanediol dehydrogenase-like
Organism
phd  Pantholops hodgsonii (chiru)
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 Semialdhyde_dh NAD_binding_2 FAD_binding_3
Motif
Other DBs
NCBI-GeneID: 102334397
NCBI-ProteinID: XP_005969700
LinkDB All DBs
Position
Un
AA seq 352 aa AA seqDB search
MKAARFYDKGDIRIEDIPEPQVQLGTVGIQVAWCGICGTDLHEFIDGPIFIPPCGHPHPI
SGEAAPVTMGHEFSGVVYAVGDGVDDIQVGQHVVVEPYIIADDVPTGPYDNYHLSKNMNF
IGLGGRGGGLSEKIAVQRRWVHPISDQIPLDQAALIEPLSVGHHAFVRSGAQSGDIALVG
GAGPIGLLLSAILKAKGLTVIITELSAKRKEKALEAGVADYVLDPSQVDVVAEVMKITQD
RGVDVAFECSSVNKVMDTLVAAMKPTGVVVIVSIWSHPATINVHSVVMKELDIRGTIAYV
NDHQETIRLVEQGKINLEPFITQRIALDDLVSQGFETLIHNNESAVKIIVHP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagctcgtttttatgataaaggggatatccgtattgaggatattccagaacca
caggtacaactaggaactgttggaatccaagtcgcatggtgtggtatttgtggcacagat
ttacatgaatttatcgatggtccaatttttattcctccgtgtggtcatccgcacccgatt
tcgggtgaagctgcacccgtgaccatggggcatgagttttcaggtgtggtgtacgctgta
ggggatggcgtggatgatattcaggtggggcaacatgttgtggttgagccttatatcatt
gcagatgatgttccgactggaccatatgacaattatcacttgtcaaaaaatatgaatttt
attggtctaggtggtcgcggtggtgggctatctgaaaaaattgcggtacaacgccgttgg
gtacatcccatttctgaccaaattcccttggatcaagccgcattgattgaacctttatct
gtcggacatcatgcttttgtaagaagtggagcacagtcaggtgatattgccttggttggt
ggagcgggcccgattggattgttattgtctgcaattttaaaggccaaaggcttaactgtc
atcattaccgagctcagtgcaaaacgtaaagaaaaagccttagaagcaggtgttgccgac
tatgtgctagatccgtctcaagtggatgttgtggctgaagtaatgaaaatcacccaagac
cgtggggtggatgtggcttttgaatgcagtagtgtcaataaggtcatggatacactggtg
gcagccatgaaaccgaccggtgtggtggtgatagtttcaatctggagtcatcctgcaacg
attaatgtgcatagtgtggtgatgaaagagctggatattcgcggcacgattgcctatgtc
aatgatcatcaagaaaccattcgcttggttgagcaaggtaaaattaatttagaacctttt
attacccaaagaattgctttagatgatttggtttcgcaaggctttgaaaccttgattcat
aacaacgaatctgcggttaaaattattgtgcatccctag

DBGET integrated database retrieval system