KEGG   Pantholops hodgsonii (chiru): 102334978Help
Entry
102334978         CDS       T02909                                 

Gene name
SLC12A8
Definition
(RefSeq) solute carrier family 12 member 8
  KO
K14428  solute carrier family 12 (potassium/chloride transporters), member 8
Organism
phd  Pantholops hodgsonii (chiru)
Brite
KEGG Orthology (KO) [BR:phd00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:phd02000]
    102334978 (SLC12A8)
Transporters [BR:phd02000]
 Solute Carrier Family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   102334978 (SLC12A8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AA_permease
Motif
Other DBs
NCBI-GeneID: 102334978
NCBI-ProteinID: XP_005982378
LinkDB All DBs
Position
Un
AA seq 714 aa AA seqDB search
MAQMSQVQELFHEAAQQEALAQPQPWWKIQLFVWEPVLFGTWDGVFTSCMINIFGVVLFL
RTGWLVGNTGVLMGVFLVSFVALVALVTVLSGIGVGEHCGVGRGGVYSMVAAVLGGQTGG
AIGLLYVFGQCVAGAMYITGFAESVSDLLSLRNIWAVRGISVAVLLALLGINLAGVKWII
RLQLLLLLLLAVSTLDFVVGSFTHLDPEHGFIGYSPELLQNNTLPDYSPGESFFTVFGVF
FPTATGVMAGFNMGGDLREPAASIPLGSLVAVGISWFLYIVFVFLLGAICIREALRYDFL
IAEKVSLVGFLFLLGLYISSLASCMGGLYGAPRILQCIAQEKVIPALACLGQGNGPNKTP
VAAICLTGLVTTAFVLVGQVNVLAPIVTINFMLTYIMVDYSYFSLAMGGCSLLERPESVP
GEGLGALHCSEPLLLEKTPSYGSEGIAQSPSEGTLLEFTKDMDQLLQLTRKLDSSQPRGG
ESHGILENQKRKTKKASKQTLQESFLLDLRSPASFSPGDADGWPTASWEGQRPHRNAQSP
RSEGDQPRGAYGAKLIPEPSNQPRPSREDFFLKSRLQEQDIQGRPTSFYTHICNPWVSLL
GAVGSLLIMFVIQWVYTLVNIGVAAMVYFYIGRTSPGLHLGLASNFSLLRWMRSLLIPSY
RSLQSPQEQIILAPSLTRVDMEMTQLTQENADFATRDRYHHSSLVSREELMPQY
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atggcccagatgtctcaagtgcaggaactcttccacgaggcagcccagcaggaagcactg
gcccagccccaaccctggtggaagatccagctgttcgtatgggagccggtgctgttcggg
acctgggatggcgtgttcacctcatgcatgatcaacatttttggggttgtccttttctta
aggaccggctggctggtgggaaacacaggcgtgcttatgggcgtgtttctggtgtccttc
gtcgccctggtggccctggtcaccgtgctgtccggcatcggggttggggagcactgcggt
gtgggccgcggcggcgtgtactccatggtcgccgcggtccttggcgggcagacgggaggc
gccatcgggctgctctatgtctttggacagtgtgttgcaggtgccatgtacatcaccggc
tttgctgaatccgtctcggatctgctgagtctcaggaatatctgggccgtgcgaggaatt
tcagtcgccgtgcttctggctttgctggggattaacctagcaggtgtcaaatggataatc
cgtctccagctgctgcttctgctcctgctcgccgtgtccaccctggactttgtggtgggc
tctttcacgcacctggacccagaacatggttttattggatactcaccagaactgctgcag
aacaatactctgccagattacagccctggagagtcctttttcactgtcttcggggtgttc
ttccccacagctacaggagtcatggccggtttcaacatggggggcgacctcagggagcct
gctgccagcatccccctgggctccctagtagcggttggcatctcgtggtttctgtacatc
gtctttgtcttcctgctcggcgccatctgcatccgagaggcccttcgctatgacttcctg
atagcggaaaaggtgtccctagtgggcttcctattccttttgggcttgtacatctcatcc
ctggcctcctgtatgggaggcctctatggagccccccggatcctgcaatgcatcgcccag
gagaaagtgatccccgcgctggcctgtttggggcaagggaacgggccaaataaaacgccg
gtagctgccatctgcctgaccggcttggtgaccacggcctttgtcctcgtgggtcaggtg
aacgtcctggcccccatcgtcaccatcaacttcatgctgacgtacatcatggtggactac
tcttacttctccctggccatggggggctgcagcctcttggagaggcctgagtcggtgccc
ggggagggcctgggtgctctccactgctctgagcccctgcttctggagaagactcccagt
tatggctctgagggcattgcccagagcccctctgagggcactctgctagaattcaccaag
gacatggatcagctcctccagctaaccaggaagctggacagtagccagcccaggggagga
gagagccatgggatcctagagaatcagaagcggaagaccaagaaggccagcaagcaaacc
ctccaagagagcttcctcttggacctcaggtcccctgcttccttctctcctggggatgct
gatggatggcctactgcctcctgggaagggcagaggccccacaggaacgcacagagtccc
agaagtgaaggggatcagcctaggggagcctatggagcaaaactcatccctgagccaagt
aaccagcccaggccaagcagagaagatttcttcctaaagtccaggctacaggaacaagat
atccaggggaggccaacttctttctacactcacatatgcaatccctgggtctccctgttg
ggggctgttgggtcccttctcatcatgtttgttatccagtgggtctataccctggttaac
ataggtgttgctgccatggtatatttctacattggtcggacaagccccggacttcacctt
ggtttagcctccaacttcagccttttaagatggatgagatcccttctgatcccctcctac
aggagcttgcaatccccccaagagcagatcattttggcaccatccctgactagggttgac
atggagatgactcagctcacccaggagaacgcagacttcgccactcgggatcgctaccac
cactcctccctagtgagccgggaagagctgatgcctcagtactag

DBGET integrated database retrieval system