KEGG   Pantholops hodgsonii (chiru): 102335353Help
Entry
102335353         CDS       T02909                                 

Definition
(RefSeq) guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12-like
  KO
K04347  guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-12
Organism
phd  Pantholops hodgsonii (chiru)
Pathway
phd04010  MAPK signaling pathway
phd04014  Ras signaling pathway
phd04062  Chemokine signaling pathway
phd04151  PI3K-Akt signaling pathway
phd04371  Apelin signaling pathway
phd04713  Circadian entrainment
phd04723  Retrograde endocannabinoid signaling
phd04724  Glutamatergic synapse
phd04725  Cholinergic synapse
phd04726  Serotonergic synapse
phd04727  GABAergic synapse
phd04728  Dopaminergic synapse
phd04810  Regulation of actin cytoskeleton
phd04926  Relaxin signaling pathway
phd05032  Morphine addiction
phd05034  Alcoholism
phd05163  Human cytomegalovirus infection
phd05167  Kaposi's sarcoma-associated herpesvirus infection
phd05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:phd00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    102335353
   04010 MAPK signaling pathway
    102335353
   04371 Apelin signaling pathway
    102335353
   04151 PI3K-Akt signaling pathway
    102335353
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    102335353
 Organismal Systems
  Immune system
   04062 Chemokine signaling pathway
    102335353
  Endocrine system
   04926 Relaxin signaling pathway
    102335353
  Nervous system
   04724 Glutamatergic synapse
    102335353
   04727 GABAergic synapse
    102335353
   04725 Cholinergic synapse
    102335353
   04728 Dopaminergic synapse
    102335353
   04726 Serotonergic synapse
    102335353
   04723 Retrograde endocannabinoid signaling
    102335353
  Environmental adaptation
   04713 Circadian entrainment
    102335353
 Human Diseases
  Cancers
   05200 Pathways in cancer
    102335353
  Substance dependence
   05032 Morphine addiction
    102335353
   05034 Alcoholism
    102335353
  Infectious diseases
   05163 Human cytomegalovirus infection
    102335353
   05167 Kaposi's sarcoma-associated herpesvirus infection
    102335353
Exosome [BR:phd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102335353
  Exosomal proteins of colorectal cancer cells
   102335353
GTP-binding proteins [BR:phd04031]
 Heterotrimeric G-proteins
  Gamma Subunits
   Gamma [OT]
    102335353
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: G-gamma
Motif
Other DBs
NCBI-GeneID: 102335353
NCBI-ProteinID: XP_005964348
LinkDB All DBs
Position
Un
AA seq 72 aa AA seqDB search
MSSKVTIGSDIGQARRAVEQLRMEAGIDRMKVSKAAADLLQFCTEQAKSDPFLVGIPAAI
NPFKEKKPCAIL
NT seq 219 nt NT seq  +upstreamnt  +downstreamnt
atgtccagcaaggtgaccattggcagtgacattgggcaagcccgccgggctgtggagcag
ctgcggatggaggcaggcattgaccgcatgaaggtatccaaggcagctgccgacctgctg
cagttctgcacagagcaggccaagagtgacccctttctcgtgggcatcccggccgccatc
aaccccttcaaggagaagaagccctgcgccatcctgtga

DBGET integrated database retrieval system